| Título: | A Polyvinylpyrrolidone Nanofibrous Sensor Doubly Decorated with Mesoporous Graphene to Selectively Detect Acetic Acid Vapors |
| Tipo documental: | info:ar-repo/semantics/artículo; info:eu-repo/semantics/article; info:eu-repo/semantics/publishedVersion |
| Fuente: | Sensors 2024, 24(7), 2174 |
| Autor/es: | Papa, Paolo; Zampetti, Emiliano; Molinari, Fabricio Nicolás; De Cesare, Fabrizio; Di Natale, Corrado; Tranfo, Giovanna; Macagnano, Antonella |
| Materias: | Sensores; Nanofibras; Vapor |
| Editor/Edición: | MDPI;2024 |
| Licencia: | https://creativecommons.org/licenses/by/4.0/ |
| Afiliaciones: | Papa, Paolo. Consiglio Nazionale delle Ricerche. Istituto sull'Inquinamento Atmosferico (CNR-IIA); Italia Zampetti, Emiliano. Consiglio Nazionale delle Ricerche. Istituto sull'Inquinamento Atmosferico (CNR-IIA); Italia Molinari, Fabricio Nicolás. Instituto Nacional de Tecnología Industrial. Textiles (INTI-Textiles); Argentina Molinari, Fabricio Nicolás. Consiglio Nazionale delle Ricerche. Istituto sull'Inquinamento Atmosferico (CNR-IIA); Italia De Cesare, Fabrizio. Consiglio Nazionale delle Ricerche. Istituto sull'Inquinamento Atmosferico (CNR-IIA); Italia De Cesare, Fabrizio. Università degli Studi della Tuscia (UNITUS); Italia Di Natale, Corrado. Università degli Studi di Roma Tor Vergata. Dipartimento di Ingegneria Elettronica (UniRoma2); Italia Tranfo, Giovanna. Ministero delle infrastrutture e dei trasporti. Dipartimento di Medicina, Epidemiologia, Igiene del Lavoro ed Ambientale (DIMEILA-INAIL); Italia Macagnano, Antonella. Consiglio Nazionale delle Ricerche. Istituto sull'Inquinamento Atmosferico (CNR-IIA); Italia |
|
|
|
| Resumen: | An original approach has been proposed for designing a nanofibrous (NF) layer using UVcured polyvinylpyrrolidone (PVP) as a matrix, incorporating mesoporous graphene carbon (MGC) nanopowder both inside and outside the fibers, creating a sandwich-like structure. This architecture is intended to selectively adsorb and detect acetic acid vapors, which are known to cause health issues in exposed workers. The nanocomposite MGC-PVP-NFs layer was fabricated through electrospinning deposition onto interdigitated microelectrodes (IDEs) and stabilized under UV–light irradiation. To enhance the adhesion of MGC onto the surface of the nanocomposite polymeric fibers, the layer was dipped in a suspension of polyethyleneimine (PEI) and MGC. The resulting structure demonstrated promising electrical and sensing properties, including rapid responses, high sensitivity, good linearity, reversibility, repeatability, and selectivity towards acetic acid vapors. Initial testing was conducted in a laboratory using a bench electrometer, followed by validation in a portable sensing device based on consumer electronic components (by ARDUINO®). This portable system was designed to provide a compact, cost-effective solution with high sensing capabilities. Under room temperature and ambient air conditions, both laboratory and portable tests exhibited favorable linear responses, with detection limits of 0.16 and 1 ppm, respectively. |
| Descargar | |
Ver+/-
sensors Article A Polyvinylpyrrolidone Nanofibrous Sensor Doubly Decorated with Mesoporous Graphene to Selectively Detect Acetic Acid Vapors Paolo Papa 1,*, Emiliano Zampetti 1 , Fabricio Nicolas Molinari 1,2, Fabrizio De Cesare 1,3 , Corrado Di Natale 4 , Giovanna Tranfo 5 and Antonella Macagnano 1,* 1 Institute of Atmospheric Pollution Research (IIA)-CNR, 00010 Montelibretti, RM, Italy; emiliano.zampetti@cnr.it (E.Z.); fabricionicolasmolinari@cnr.it or fmolinari@inti.gob.ar (F.N.M.); decesare@unitus.it (F.D.C.) 2 National Institute of Industrial Technology (INTI), Buenos Aires B1650WAB, Argentina 3 Department for Innovation in Biological, Agro-food and Forest Systems (DIBAF), University of Tuscia, 01100 Viterbo, VT, Italy 4 Department of Electronic Engineering (EED), University of Tor Vergata, 00133 Rome, RM, Italy; dinatale@uniroma2.it 5 Department of Medicine, Epidemiology, Occupational and Environmental Hygiene (DIMEILA)-INAIL, 00144 Monteporzio Catone, RM, Italy; g.tranfo@inail.it * Correspondence: paolo.papa@cnr.it (P.P.); antonella.macagnano@cnr.it (A.M.) Citation: Papa, P.; Zampetti, E.; Molinari, F.N.; De Cesare, F.; Di Natale, C.; Tranfo, G.; Macagnano, A. A Polyvinylpyrrolidone Nanofibrous Sensor Doubly Decorated with Mesoporous Graphene to Selectively Detect Acetic Acid Vapors. Sensors 2024, 24, 2174. https://doi.org/ 10.3390/s24072174 Abstract: An original approach has been proposed for designing a nanofibrous (NF) layer using UVcured polyvinylpyrrolidone (PVP) as a matrix, incorporating mesoporous graphene carbon (MGC) nanopowder both inside and outside the fibers, creating a sandwich-like structure. This architecture is intended to selectively adsorb and detect acetic acid vapors, which are known to cause health issues in exposed workers. The nanocomposite MGC-PVP-NFs layer was fabricated through electrospinning deposition onto interdigitated microelectrodes (IDEs) and stabilized under UV–light irradiation. To enhance the adhesion of MGC onto the surface of the nanocomposite polymeric fibers, the layer was dipped in a suspension of polyethyleneimine (PEI) and MGC. The resulting structure demonstrated promising electrical and sensing properties, including rapid responses, high sensitivity, good linearity, reversibility, repeatability, and selectivity towards acetic acid vapors. Initial testing was conducted in a laboratory using a bench electrometer, followed by validation in a portable sensing device based on consumer electronic components (by ARDUINO®). This portable system was designed to provide a compact, cost-effective solution with high sensing capabilities. Under room temperature and ambient air conditions, both laboratory and portable tests exhibited favorable linear responses, with detection limits of 0.16 and 1 ppm, respectively. Academic Editor: Iren E. Kuznetsova Received: 1 March 2024 Revised: 22 March 2024 Accepted: 24 March 2024 Published: 28 March 2024 Copyright: © 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https:// creativecommons.org/licenses/by/ 4.0/). Keywords: acetic acid detection; electrospun nanocomposite nanofibers; mesoporous graphene; selective sensor; portable sensing tool 1. Introduction Currently, polymer nanocomposites represent one of the most significant areas of focus in polymer chemistry and nanotechnology research, including coating and printing [1–3], smart packaging [4], advanced electronics [5], energy storage and conversion devices [6], biomedical tools [7], drug delivery vehicles, antimicrobial materials [8,9], and sensor technology [10]. Polymer nanocomposites have sparked considerable interest in sensor applications over the past few decades, emerging as pivotal components in sensor system design. Hence, given the demand for innovation in sensors and the transition from traditional to high-performance, portable, and nanoscale systems, the scientific community has extensively investigated the development of advanced combinations of nanomaterials and polymer matrices for sensor applications. This interest is largely aroused by the Sensors 2024, 24, 2174. https://doi.org/10.3390/s24072174 https://www.mdpi.com/journal/sensors Sensors 2024, 24, 2174 2 of 22 multitude of advantages these materials offer, such as their outstanding electrical and mechanical properties, sensitivity, and simplicity of manufacturing [11]. Actually, the exceptional blend of versatility, processability, functionalization, biocompatibility, scalability, and customized properties renders nanocomposite polymers highly appealing for sensor nanotechnology, facilitating diverse applications. These sensors can be synthesized on a large scale through cost-effective methods, rendering them economically feasible for mass production. Additionally, they can be imbued with a diverse array of functional groups, additives, or nanoparticles to confer specific properties, such as conductivity, biocompatibility, or responsiveness to distinct external stimuli. In this study, a selective sensor for acetic acid vapors based on the combination of non-conductive polymer nanofibers (polyvinylpyrrolidone, PVP) with nanopowders of mesoporous graphitized carbon (MGC) is described. As far as authors know, there is limited literature on specific acetic acid vapor sensors [12–21], and they are not commonly found among commercially available sensor options [22–25]. So far, the rarity of commercial sensors specifically designed to detect acetic acid vapors (for instance, based on electrochemical cells [26] or colorimetric sensing technology [27]) could be attributed to several factors. The use of acetic acid sensors is often limited to specific industries or applications where the detection of acetic acid vapors is critical, such as in chemical manufacturing (e.g., paints, adhesives, plastics, and textile finishes, cleaners), food processing (e.g., flavoring, preservation, acidification, and sanitizing), or pharmaceutical production (e.g., solvent in synthesis, pH adjustment, drug delivery systems, and excipient in formulations). This specialization restricts their widespread adoption compared to sensors for more commonly monitored gases. Additionally, detecting acetic acid vapors accurately and selectively can be technically challenging due to factors such as interference from other gases, VOC cross-reactivity, variability in concentration levels, and the need for high sensitivity and specificity. Overall, while acetic acid sensors play a vital role in certain niche applications, their limited demand, technical challenges, cost considerations, and regulatory factors may contribute to their specialized status compared to sensors for more commonly monitored gases. Additionally, acetic acid is considered an environmentally friendly chemical since it is biodegradable and produced from renewable sources according to sustainable routes [28]. On the other hand, its vapors are hazardous, with potential health risks (respiratory irritation, eye irritation, skin burns, and other health problems) overall for people exposed to high concentrations over prolonged periods. Occupational exposure to acetic acid can occur through inhalation, skin contact, or eye contact. Acetic acid is corrosive to the skin and eyes, and the Occupational Safety and Health Administration (OSHA) has established standards for exposure to it. In Europe, the indicative occupational exposure limit value (IOELVs, from Commission Directive 2017/164/EU) for acetic acid is 10 ppm (25 mg/m3) over an 8 h work shift, and the shortterm exposure limit (STEL) is 20 ppm (50 mg/m3) [29]. The main symptoms of exposure to acetic acid vapors at this level may include irritation of the eyes, nose, and throat. At concentrations of 100 ppm, individuals may experience significant lung irritation and possible damage to the lungs, eyes, and skin. Exposure to acetic acid can also lead to pharyngeal edema and chronic bronchitis. Therefore, wearable sensors for acetic acid gas could play a vital role in protecting the health and safety of workers, ensuring regulatory compliance, and enhancing process efficiency and safety in industries where acetic acid is used. In the last decade of literature, most of the planned and investigated sensors to monitor acetic acid used nanostructured metal oxide and their combinations for chemiresistors, which required high temperatures (ranging between 150 and 380 ◦C) to achieve high sensing performances (data listed in Table 1, Section 3.2) [13]. Their LODs varied between 10 ppb and 50 ppm, depending on the quality of doping and nanoarchitecture. Some dopants were selected for their catalytic properties; others were selected for their ability to create finer microstructures or grain boundaries, thereby increasing the surface area available for interaction with acetic acid molecules. For instance, electrospinning technology Sensors 2024, 24, 2174 3 of 22 was employed to enhance the sensitivity of In2O3 for detecting HAc. The resulting highly porous and interconnected structure enabled the detection of the analyte at a concentration of 500 ppb when the sensor operated at 250 ◦C [21]. Conversely, ZnO was explored as a promising compound for detecting acetic acid at both high and room temperatures. The sensitivity of ZnO varied depending on whether it was in the form of hexagonal nanocrystals or foam surfactant [16], highlighting that an increase in the density of surface defects and active sites within a nanoarchitecture enhanced interactions with the analyte. By the way, the foam variant achieved an LOD of 500 ppb at a working temperature of 400 ◦C. The integration of a porous metal–organic framework (Tb2O3@MOF) [17] with ZnO enabled the sensor to operate effectively at room temperature. However, to enhance sensor sensitivity and achieve an LOD of 500 ppb, UV light excitation was employed. Conversely, sensors based on GQDs–ZnO composites (GQDs: graphene quantum dots) could be operated at room temperature and exhibited a stronger response to acetic acid gas compared to a pure ZnO sensor, detecting up to 1 ppm at room temperature [30]. The mesoporosity of a metal oxide (CuO) was utilized to create a sensor operating at 200 ◦C [31], whereas the incorporation of graphene (RGO or G) in conjunction with metals [32] or ceramics [33] enabled chemiresistors to function at room temperature with exceptional sensitivity (achieving a limit of detection of up to 1 ppb [34]). Avossa et al. (2018) reported that a chemiresistor based on ES nanofibers of a blend of polystyrene and polyhydroxybutyrate (PS-PHB) hosting MGC (0.93% mass ratio) was sensitive and selective to acetic acid vapors, but only worked at a temperature slightly higher than room temperature (T = 40 ◦C). The mesoporous structure, with a 137 Å average pore diameter, acted as a nucleation center for entrapping and growing acetic acid. Since the sensor did not appear to reach a plateau quickly, an LOD was not reported [35]. The necessity of the sensor to work at more elevated temperatures appeared to be related to the polymer’s structure and the heterogeneous network architecture of MGC within the fibers. By changing the hosting polymer, the electrical and sensing features could be improved. Thus, in the present study, the mesoporous graphene nanopowder was dispersed in a PVP solution to obtain nanocomposite nanofibers by electrospinning (PVP-MGC NFs). PVP looks like a popular choice for electrospinning technology [36] due to the combination of a series of features like excellent solubility in a wide range of solvents, including aqueous eco-friendly solvents, good electro-spinnability due to the formation of a stable jet under the influence of an electric field, blend compatibility, biocompatibility, and non-toxicity, allowing for the development of diversified nanofibers with enhanced mechanical and electrical properties, and cost-effectiveness. On the other hand, PVP;s solubility in water also renders it a delicate material for sensing layers. Exposing it to UV–light irradiation for a brief period generates radicals, leading to the formation of new bonds between the chains within the individual fibers. This process makes the fiber insoluble or alters its solubility in various solvents, imparting new chemical and physical properties, along with enhanced stability, that are contingent upon the duration of UV–light exposure [37]. The use of mesoporous graphene as a nanofiller is of significant interest in sensor applications [38] due to the combination of the excellent conductivity of graphene with a network of periodic mesopores, increasing the available surface area for interactions with surrounding molecules and electrons. More specifically, MGC consists of a single layer of sp2 carbon atoms bonded in a hexagonal honeycomb crystalline arrangement with exceptional physical properties, including high carrier mobility (up to 350·103 cm2/(Vs)), thermal stability (as demonstrated by Bolotin et al., 2008 [39]), and high mechanical strength (with a Young’s modulus of 1 TPa and fracture strength of 130 GPa), and it is also then able to impart both conductivity and increased mechanical strength to the nanofibers. Additionally, the mesoporous structure, providing a larger available surface area (50–100 m2/g) to the nanopowder, offers the potential for enhanced selectivity through molecular size exclusion effects (with an average pore diameter of 137 Å). This material, pristine or oxidized and in combination with other compounds, has primarily found applications in the energy sector, catalysis, selective gas adsorption [40], and in bio- and chemical sensing [41–44]. Sensors 2024, 24, 2174 4 of 22 Electrospinning technology is a versatile and scalable technique for producing nanocomposite nanofibers with controlled morphology and composition, offering a versatile and effective approach for designing wearable sensors with enhanced sensitivity, selectivity, flexibility, and biocompatibility, making it a promising strategy for various applications in healthcare, environmental monitoring, and beyond [45–48]. The versatility of electrospinning technology allows for the creation of advanced and sophisticated sensing layers that are compatible with electronics and electronic nanodevices [49]. Electrospun nanofibers have an exceptionally high surface area-to-volume ratio, which provides a large interface for interactions with target analytes. This increased surface area is expected to enhance the sensitivity of sensors by maximizing the number of active sites available for molecular adsorption and detection. The deposition process allows for precise control over the morphology, structure, and composition of nanofibers, enabling the design of sensing layers with specific properties tailored to the requirements of the target analyte and sensing application. The resulting nanofibrous sensing layers are inherently flexible and can conform to a plethora of surfaces, making them suitable for integration into wearable and conformable sensor devices. Further, electrospinning is a scalable manufacturing technique that can produce nanofibrous sensing layers over large areas and volumes. This scalability is essential for the commercialization and widespread adoption of sensing technologies in various applications and industries. The electrospinning technique involves applying a high voltage, in the range of several kilovolts, between the spinneret of a spinnable polymer solution and a collector equipped with the transducer. The collected nanofibers may undergo additional processing steps, such as drying or crosslinking, to improve their mechanical properties and stability. The choice of polymer solution (i.e., based on homopolymers, blends, nanocomposites, metal oxide precursors, etc.) depends on the desired properties of the nanofibers and the intended application of the sensing electrospun materials [50]. It has been proven that the distribution of mesoporous graphene (MGC) within the electrospun polymer nanofibers [51–55] depends on factors such as the graphene/polymer mass ratio, the affinity to the hosting polymers, and the parameters of the electrospinning process. Storti et al. (2023) [56] successfully embedded graphene nanoplatelets into PVP nanofibers without further additives, achieving homogeneous distributions through pulsed ultrasonication and testing as an antimicrobial tool. Similarly, Del Sorbo et al. (2019) [57] developed nanocomposite fibers of PVP and non-covalently functionalized graphene through tip sonication of graphene alcoholic suspensions in the presence of PVP and used them as sound absorbing-materials. In this study, the architecture of PVP-MGC nanofibers was developed over a commercial interdigitated electrode (IDE) to function as a sensor for the rapid and selective detection of acetic acid vapors, operating within the previously mentioned permissible exposure limits (PELs) established for acetic acid [28] and serving as a promising candidate for integration into portable monitoring systems aimed at protecting workers. The selection of UV-cured PVP nanofibers as the matrix aims to ensure the long-term stability and performance of the sensor device, even under harsh operating conditions. To enhance both electrical conductivity and sensing features, the outer layer of the nanocomposite nanofibers was additionally decorated with MGC nanopowder, serving the dual roles of filler and surface binding agent. The mesoporous structure of MGC should provide abundant active sites for analyte adsorption, leading to enhanced sensing sensitivity. Additionally, the high conductivity of graphene is expected to facilitate efficient electron transfer, resulting in rapid and responsive sensing performance. The double decoration of PVP nanofibers with MGC nanopowder aims to synergistically enhance the sensor’s sensitivity, selectivity, and stability for detecting acetic acid vapors. Preliminary measurements were carried out by connecting the sensor to an electrometer to detect changes in current. Subsequently, the sensor was incorporated into a portable sensing device using the Arduino architecture system. It was then subjected to analyte detection tests for a few Sensors 2024, 24, 2174 5 of 22 tens of seconds, covering the concentration ranges of interest. This approach is in line with the objective of developing a portable system capable of providing a cost-effective and transportable solution with advanced sensing capabilities for use in workplace risk scenarios. 2. Materials and Methods 2.1. Materials All the materials and chemicals used in this work were of analytical grade and used as received. Mesoporous graphitized carbon nanopowder (MGC, >99.95%, <500 nm DLS, 50–100 m2/g, <200 nm particle size), polyvinylpyrrolidone (PVP, Mw~1,300,000), ethanol anhydrous (EtOH 99,8%), polyethyleneimine (PEI, Mw~423), acetic acid (HAc, ≥99%), formic acid (FA, ≥98%), methanol (MeOH, ≥99.8%), acetone (Ac, ≥99.5%), triethylamine (TEA, ≥99.5%), and butylamine (ButA, ≥99.5%) were purchased from Merck KGaA (Darmstadt, Germany). Interdigitated electrodes (IDEs), supplied by Micrux Technologies (Gijón, Spain), were fabricated on glass substrates (IDE dimensions: 10 × 6 × 0.75 mm, Pt/Ti electrodes, 120 pairs, 10 µm wide × 5 mm long × 150 nm thick, with a 10 µm gap). Prior to use, the electrodes were cleaned with a soap solution and a “base piranha” mixture at 60 ◦C for approximately 30 min (3:1, v:v, ammonia water, and hydrogen peroxide water solution), followed by rinsing with Milli-Q water (~18 MΩ cm). 2.2. Sensor Material Growth The MGC suspension, prepared by subjecting it to pulsed ultrasonication (10 min, Branson 1800) followed by alternating vortexing and magnetic stirring until a dark ink-like liquid was achieved, was combined with the PVP/EtOH solution (C: 58.2 mg/mL). The mixture was blended until a PVP:MGC solution ratio of 1:0.0045 (w:w) was obtained for electrospinning and loaded into a syringe placed inside the electrospinning deposition chamber. The fiber deposition process was carried out using a Fluidnatek® LE-50 electrospinning machine (Bioinicia, Paterna, Valencia, Spain). To ensure the production of uniform and dry fibers, the distance between the needle and the collector was set at 9 cm, with a solution flow rate of 400 µL/h. In the electrospinning setup, the needle was charged to a voltage of +4.6 kV, while the collector maintained a potential of −2 kV (Figure S1). A rotating drum collector (500 rpm) was applied to promote a more organized alignment of the fibers Sensors 2024, 24, x FOR PEER REVIEWduring deposition. Once the electric potential was applied, the polymeric disper6sioofn2j2et coated the interdigitated electrodes (IDEs) secured to the collector using conductive tape and positioned inside the deposition cone; see Figure 1A. FiFgiugruere1.1S. cShcehmeme eofotfhteheeleelcetcrtorsopsipnininnigngdedpeopsoistiotinonprporcoecsesss(A(A),)U, UVV–l–iglihgthct ucurirnigngofofththeePPVVPP-M-MGGCC nannaonfiobfirboruous sesnensisningglalyaeyre,r,(B(B) )aannddMMGGCC-P-PEEI Icocoaatitninggoof fNNFFssbbyyddipipppiningg(C(C).). 2.3. Material Characterization The scanning electron microscopy (SEM) technique was employed to characterize the size, shape, architecture, and surface properties of the nanofibers. Specifically, nanofibrous fabrics produced via electrospinning were deposited onto thin SiO2 wafers and Sensors 2024, 24, 2174 6 of 22 The UV–light photocrosslinking of the polymer composite nanofibers occurred using a 500 W UV lamp (Polimer Helios Italquartz, Cambiago, MI, Italy) emitting in a spectrum range from 180 nm to visible light for 10 min. Samples were placed 10 cm away from the light source, with the film temperature set to 28 ◦C by a Peltier cell; see Figure 1B. The dipping suspension contained polyethyleneimine (PEI, C: 10.7 mg/mL) and MGC (C: 0.4 mg/mL) in EtOH, previously subjected to pulsed ultrasonication, vortexing, and magnetic stirring. The deposition by dipping occurred using a custom-built system, enabling precise control and regulation of both immersion and withdrawal speeds set at 1 mm per second; see Figure 1C. A scheme of the entire deposition process and sensor development is represented in Figure 1. 2.3. Material Characterization The scanning electron microscopy (SEM) technique was employed to characterize the size, shape, architecture, and surface properties of the nanofibers. Specifically, nanofibrous fabrics produced via electrospinning were deposited onto thin SiO2 wafers and gold sputter-coated using a Balzers MED 010 unit. These samples were then analyzed using a JEOL JSM 6010LA electron microscope at the High Equipment Centre, University of Tuscia, Viterbo, Italy. The average diameter of the fibers was determined using Gwyddion© 2.64 software (GNU General Public License), with measurements conducted on a total of 150 fibers per sample. The normal probability distribution was calculated based on the respective means and standard deviations using Microsoft® Excel® (Microsoft 365 MSO, version N. 2402). Quality assessment of fibers on the IDE surface was conducted utilizing an optical microscope, specifically the Leica DM2700M (Leica Microsystems CMS GmbH, Wetzlar, Germany), with observations made at magnifications of 20×, 50×, and 100×. The images were captured by Leica DMC4500 camera under incident light in brightfield using the LED lamp LH113, as well as in fluorescence using the Lamp EL6000 with FITC-Texas filters for green and blue excitation, respectively. Transmission electron microscopy (TEM) micrographs were acquired at 200 keV using a transmission electron microscope equipped with an analytical double-tilt probe. Electrospun nanofibers were collected in static mode on nickel grids (Gilder Grids, 50 mesh, 3.05 mm O.D., Nickel) for a few seconds and observed without any fixative or staining using a JEOL 1200EXII electron microscope (JEOL, Peabody, MA, USA). Micrographs were captured using an SIS VELETA CCD camera (Olympus, Muenster, Germany) equipped with iTEM software (TEM Imaging Platform). 2.4. Sensor Measurement Systems Setup The measurements presented in this study were initially conducted on a laboratory bench system and later replicated (in the same measurement conditions) using a low-cost portable measurement device. The two-system setup is depicted in Figure 2A,B. As previously mentioned, the vapor tests were performed with the stationary measurement system; see Figure 2A. In this way, the resulting chemiresistor (consisting of IDEs and NFs, where NFs refers to nanofibers) was enclosed in a measuring chamber with a volume of approximately 3 mL, and then linked to an electrometer (Keithley 6517, Solon, OH, USA) capable of both powering and measuring its electrical outputs, with data transmission to a PC facilitated by LabVIEW Software (2014) from National Instruments (Austin, TX, USA). The current, recorded under clean air conditions, was monitored by applying potential values ranging from 0 to 2.0 V in increments of 0.2 V, with humidity percentages and temperature values strictly controlled. The resistance (R) of the fibrous coating and its relationship to humidity at 25 ◦C (45% RH) were determined using Ohm’s Law, which states that the resistance of a circuit equals the voltage across it divided by the current flowing through it. VOC measurements were carried out by applying 1 volt of potential. The measurement chamber was conditioned by a customized pneumatic system necessary to generate the desired vapor concentrations. It comprised a mass flow control Sensors 2024, 24, 2174 7 of 22 (MFC) with a range capacity of 0–200 standard cubic centimeters per minute (sccm) man- aged by a 4-channel readout controller (MKS Type 247 from MKS Instruments, Andover, UK), an electrovalve to switch the fluxes (S070C-RAG-32 from SMC Corporation, Tokyo, Japan), and an air pump (NMP015, KNF, Freiburg im Breisgau, Germany) to generate a carrier ambient air flux, which was previously purified, passing through a carbon-activated cartridge. All the connections between Teflon tubes were guaranteed by Festo (Festo AG & Co. KG, Esslingen, Germany) push-in connectors. An air cylinder (5.0, Nippon Gas Italia S.r.L., Milan, Italy) was used as a carrier gas in the circuit dedicated to the bubbling and collection of VOC vapors. This configuration facilitated the generation of precisely controlled concentrations of volatile organic compounds (VOCs). The concentration range for acetic acid was determined based on its application range (0.95–30 ppm), while for Sensors 2024, 24,axllFOoRthPeErERVROECVIsE,Wthe concentration range was selected to ensure it reached at least a value 7o detectable by the sensor (FA: 5–440 ppm, NH3: 7–755 ppm, MeOH: 14–2245 ppm, EtOH: 7–930 ppm, Ac: 25–4125 ppm, TEA: 17–1350 ppm, and ButA: 16–1690 ppm). Figure 2. LayoutFoigfutrhee2m. Leaaysouurtemofetnhte tmesetassupreermfoernmt etedstws pitehrftohremsetdatwiointharthye(sAta)taionndartyhe(Ap)oarntdabtlhee portable (B) system. system. The second measAusripnrgevsieotusply(Fmigeunrteio2nBe)d, ,sitmheilvaarpoonrttheestps nweeurme pateircfosirdmee, dcownistihsttehdeosftaatnionary me electronic board u(arnemanenaltosgysbtoemar;ds)eceoFninguecrtee2dAt.oInanthIiDs Ewtahya,thceonrevseurltteidngthceheemleicrtersicisrteosri(sctoansciesting of ID variations into vaonldtagNeFvs,awriahteiroenNs;FsseereFfiegrus rteo 3nAan. oAfi1b6e-rbs)itwaansaleongcltooseddigiintaal cmoenavseurrtin(Ag DchCa)mber wit module (ADS11v1o5lubmy eAonfaalopgprDoxeivmicaetse,lyW3ilmmLin, agntodnt,hMenAli,nUkeSdAt)o, Faingeulreect3rBom, ceotnerv(eKrteeitdhltehye6517, Sol analog signals inOtoHd,iUgiStAal)ocnapesa.bAle mofibcroothcopnotwroellreinr g(AarnddumineoasNuarninog, bitys eAlercdturiicnaol oSuAt,pCuhtsi,awssioth, data tra Switzerland), Fimguisrseio2nB,toacaqPuCirefadcialintadtetdrabnysmLaitbtVedIEtWheSgoeftnweararete(d20d1a4t)afrtooma NcoamtiopnuatleIrnustnriutments (A through a USB ptoinrt,.TAX,sUofStAw)a. rTehpercougrrraemnt,(rdeecvoerldoepdeudnbdyerLcalbevaniewair) ceolanbdoirtiaotnesd,,wpalostmteodn, iatnorded by app stored these datianignproetaeln-ttiimalev.aTluhees sraonftgwinagrefreoxmec0uttoed2.0mVeainsuinrecmremenetnctys colfe0s.2anVd, wgietnhehruatmedidity perce text files (.txt or a.cgsevs).and temperature values strictly controlled. The resistance (R) of the fibrous coat In this waya, nthdeitssyrsetleamtiocnosuhlidp rtoeghiustmeridthitye patre2s5e°nCce(4o5f%poRsHsi)bwleetrherdeestheormldinleevdeulssianngdOhm’s La provide the posswibhiliicthy sttoatseusbtsheaqtuthenetrleysaisntaanlyczeeotfhaecsitrocureitdedqautaal,sgthiveinvgolatalgoenagc-rteorsms itadvievriadgeed by the c concentration torwenhtiflcohwthinegotpherroautgohr iwt.aVsOeCxpmoseeadsu. rements were carried out by applying 1 volt of pot Finally, in toiardl.eTrhteomoepaesuraretem, etnhtechenamtirbeerpworatsacbolnedsiytisotneemd breyqauciuresdtoma ipzeodwpenresuumpaptliyc system n (5 V DC) that waessscaornynetoctgedenteorathtee tmheaindsespiroewdevr.aIptowr acsonlocceantterdataiotnths.eIbtoctotommproisfetdheasymsatesms fl, ow cont as depicted in Fi(gMuFreC)3Dw.ith a range capacity of 0–200 standard cubic centimeters per minute (sccm) m aged by a 4-channel readout controller (MKS Type 247 from MKS Instruments, Andov UK), an electrovalve to switch the fluxes (S070C-RAG-32 from SMC Corporation, Tok Japan), and an air pump (NMP015, KNF, Freiburg im Breisgau, Germany) to generat carrier ambient air flux, which was previously purified, passing through a carbon-a vated cartridge. All the connections between Teflon tubes were guaranteed by Festo (Fe AG & Co. KG, Esslingen, Germany) push-in connectors. An air cylinder (5.0, Nippon G Italia S.r.L., Milan, Italy) was used as a carrier gas in the circuit dedicated to the bubbl and collection of VOC vapors. This configuration facilitated the generation of precis controlled concentrations of volatile organic compounds (VOCs). The concentration ran for acetic acid was determined based on its application range (0.95–30 ppm), while for other VOCs, the concentration range was selected to ensure it reached at least a va detectable by the sensor (FA: 5–440 ppm, NH3: 7–755 ppm, MeOH: 14–2245 ppm, EtO rated, plotted, and stored these data in real-time. The software executed measurement cycles and generated text files (.txt or .csv). In this way, the system could register the presence of possible threshold levels and Sensors 2024, 24, 2174 provide the possibility to subsequently analyze the stored data, giving a long-te8romf 22aver- age concentration to which the operator was exposed. Figure 3. Representation of the portable measurement system with a layered structure in analogue Figure 3. Rbeoparreds(eAn),taAtDioCnmoofdtuhlee (pBo),rmtaibcrloecomnteraoslluerre(Cm),eanntdstyhestpeomwewr siuthppalyla(Dye).red structure in analogue board (A), ADC module (B), microcontroller (C), and the power supply (D). 3. Results and Discussion Final3ly.1,. iSnenosirndgeMr attoeroiapl Cerhaartaec,tetrhizeateionntire portable system required a power supply (5 V DC) that was cEolenctnroescpteindnitnogtthecehmnoaloingys fpacoiwlitaetre.dItthwe aonsel-ostceaptecrdeaatitotnhoefbnoanttoocmomopfostihteensaynsotfei-m, as depicted iibnnrcoFluuisgdluianyrgeerss3iluDicso.inngdaiosxinidgeletnheinedslleic. eDsefpoorsmitioornpshwoleorgeiecaaslialynpdeorpfotricmael dchoanravcatreiroiuzsatsiuobnsotrfatthese, fibers and customized borosilicate interdigitated electrode (IDE) transducers for measuring 3. ResultsthaenedleDctriisccaul asnsdiosnensing properties of the thin nanofibrous coating. 3.1. SensinngeeMdElaeattecihrpis,auel fbCfsicthriaaetnreat,lcysteeccrouilrzleealctytieofidnxethdeoenjteoctthede grounded rotating cylinder fibers. The electrospun jet and aligned with the streams maintained Electuronsinptienrrnuipntgedteflcohwn, oleloadgiyngfatcoiltihteatfeodrmtahteioonnoef-astfeibprocuresanteitownoorkf nwaitnhoincoammperoesiftoeurnano- fibrous laymeirnsutuess.inThgeaexspinosgulree nofePeVdPlen. aDnoefpiboesristitoonUsVwligehrteireraasdiilaytiopnewrfaosremxpeedctoedntovainriitoiautes substrates, incthluedpihnogtoscirloicssolinnkdiinogxoidf ethtehpinolsylmiceersinfotrhme soorlipdhsotaloteg, iaciadledanbdy othpetipcraoldcuhctairoancotef rOiz3ation of the fiberardsicaPanVlsdPi,ncbtuehisnetgsouwmrariotzeuren-dsdoilnbugoblareoira.snildicaalstoesionlutbelrediingeitthaatneodl aenldecmtroostdpeol(aIrDsEol)vetnrtasn, issdinuhceerr-s for measuringentthlyeferalegcilteraicnadlnaontdidseeanl fsoirnsgenpsrinogpaeprtpileicsaotifonths.ePtrheviniounsasntuodfiibesrohuavsecdoeamtionngs.trated EachtshuatbUstVrairtrea,dsiaetciounrecalyn ffioxrmedinosonltuobltehaendgrpohuotnodcreodsslrionktaedtinPgVPcystlriuncdtuerresa[n5d8].aDliegpnenedd- with the needleingtipon, tehffie dciuernattiloyn coof lelxepcotseudret,htheeseejebcotnedds mfibadeerst.heTPhVePefliebcetrrsoinsspoulunbljeeotrsdtrifefearmenstlymaintained unsainonltduebirnlrecurienpatvseeaddriosfltuaosbwsiloi,ltvyl.eenatds,ienngdotowitnhgethfeomrmwaitthioanlteorefdachfiebmriocaulsanndetpwhyosrickalwpriothpienrtiaesmere four minutes.InTihtiaelley,xPpVoPsunarenoofifbePrVs wPerneagnroowfibneurssintgoidUenVticliagl heltecitrrroasdpuiantidoenpowsitaiosnepxapraemct-ed to initiate thetperhsofotor cbroothssvlienrskioinngs, owfitthheanpdowlyitmhoeurtitnhethinecsluosliiodnsotfaMteG, aCid(Feidgubrye Sth1)e. pDruoedtuo cittsion of O3 radicalasminphtihpehisliucrsrtoruucntudrein, cgomaipr.rised of a hydrophilic pyrrolidone moiety and hydrophobic herenPtVlyP,fiaarnbnlaksedgytialdinnlgiegcsrpeow,aeuWrnpsasdiatb,jeiiPldrniV-toeysPtotohalfialudg.sbrrebaelaeppeelhonaerfntcnoeoedrdmatasnmheldesonionutssltiysindloeiegzmlrauivtpabialopoltneipyveoleidinfscPaianesVttibaPhoocanatahnspsao.apqilsPnutagraeneboavuidglsiiezomnaiuntnotgdsosaoetsgrntgpeuhanoadntnliiafcceoressrotsdhlhoveiselasvpnvteetaesrbn.sitiFldnisoteg,yrmisoinn-strated thaptrisUtiVneigrrraapdhieanteioatnhcigahncfoonrcmentirnatsioonlus abclreosasnadwpidheortaoncgreoosfsolrignakneicdsoPlVvePntsst[r5u9]c.tTuhruess, [58]. DependinaggooondtdhiespderusiroantioofnMoGfCewxapsoesxupreect,etdh. ese bonds made the PVP fibers insoluble or differently solSuubblseeqinuevnatlryi,otuhesnsaonlovfeibnetrss,wenerdeoswubijnecgtetdhteomUVw–iltighhat litrerardeidatciohne.mical and physical propertiesmaantiodTnhisen, sacesrfeeivbaiesdreesdnecxeshdtiabbbiyteiltdhiteayfu.lunoifroersmcensctreuocptutircealwmitihcoroustcaonpyy apparent beads or globular forimages depicted in Figure 4A,B. InitiaWllyhi,lePPVVPPnisannootfitybpeicrasllwy ererceoggnriozewdnasuasiflnugoriedsceennttipcoallymeleerc, tirtodsepmuonnstdraetpesossiigtnioifnicapnat ram- eters for both versions, with and without the inclusion of MGC (Figure S1). Due to its amphiphilic structure, comprised of a hydrophilic pyrrolidone moiety and hydrophobic alkyl groups, PVP has been commonly employed as a capping agent to enhance the orescence emission intensity and brightness. This effect could be attributed to a combina- tion of factors, including enhanced light absorption by the mesoporous graphitized car- bon, promoting a more efficient excitation of fluorescence within the nanofibers. Addi- tionally, synergistic effects between materials could occur, such as charge transfer phe- Sensors 20n24o, 2m4, e21n74a, thus contributing to changes in the optical properties of the nanofibers. 9 of 22 Conversely, transmission electron microscopy (TEM) images reveal distinct charac- teristics between thinetritnwsicofltuyopreessceoncfep, poalrytivcuinlayrllypuynrdreorlciodnodniteion(Ps oVfPph)ontoa-noxoidfiabtieorns[6(0F,6ig1]u. Trehe4dCis,tDin)g.uishThe first type exhibinigtsfeaastumreoboetthweaenndthreetgwuolfaibremr toyprpeshios lhoigghyli,gwhtietdhbuynviafroiartmionds iianmflueotreerscaenncde seumri-ssion face texture, as obisnetrevnseidty ianndthbreigThtEnMess.imThaisgeeffeinct cFoiugludrbee a4tCtri.bIuntedcotontarcaosmt,btinhaetiosnecoof nfadctotrys,pinecolufding PVP contains buncehnheasnocefdMligGhtCabasloornptgionthbey fithbeemresstorpuocrotuusreg,rarpehsiutizlteidncgaribnonlo, pcraolmizoetidnghaummopreseoffircient slight irregularitieresixaiclnsitactothiuoelndoeofxcfctlueurro,nrseuascclhesnahcseacwphaeitrhgoienftrtthahneesnfeafirnbpoehfireb.neorTsm.hAeendaPd,VitthiPouns-aMclolynG,tsrCyibnufietribgniegsrttisoc ceshfefaerncvtgseedbseintawstheetehnoepmtiactaelscaffold for the conpdroupcerttoiems oeftrthice nsaennosfoibrerds.esigned to detect acetic acid. Figure 4. FluorescenFt iogpurteic4a.lFmluiocrreoscsecnotpoeptviciaelwmsicorofsPcoVpPe vNieFwss(oAf P) VaPndNFPsV(AP)-ManGd CPVNP-FMsG(CB)NcFosl(lBec) tceodlleoctned on SiO2 slice; TEM pictuSriOes2 oslficPe;VTPEM(Cp)icatunrdesPoVf PPV-MP (GC)Can(Dd P) VnPa-nMoGfiCbe(Drs).nanofibers. As reported iinstiFcisgCbuoentrwveee5resAnelt,yh,tehtrteawniosnmttyiesprsedisoinogfeitpleaoctlteyrdovninemylleipccyrtorrrsoocdolipdeyosn(wTeE(iPtMhV)Peim)lenacagtnerosofrisbepveuresanl(Fdniigsautnirneocfit4Ccbh,eDarr)sa. cTthereexhibited uniformficrostvteyrpaegeex,hfiboirtsmaisnmgoaotnheatnwdorergkualarrcmhiotrepchtoulroegyc,hwairthacutneirfoizrmeddbiaymcetoenr sainsdtesnutrface microporosity. Thetesxetuproer, eas owbeserrevseudpinptohseeTdEtMo simeravgee ains Fpiaguthrew4aCy. sInfocorngtarasst,rathnesspeocornt,dthtyepreebofyPVP bolstering the matecorniatal’isnssbuuitnacbhielsitoyf MfoGrCgaalso/nVgOthCe fsiebnerssintrgucatuprpe,lirceasutiltoinngs.in localized humps or slight set) hOigphtliicgahl tmaicpraorifsrotcrireoatglhpuAleyelsacrpaorietnliipicdegotsuunrictnreteeoddtmshieonoertefFrixieiFctgenisurgtenrauneatslri5oeosArhn5,datBpeohse,feiEgoinnfnaaettnhednerdodtfofiiiSgbdbEeietreMat.ertTecshdtmaeaesciPlceeVdtrcioPtcerg-poaMcrdoiaGedspsi.CthwefsidibthoearfesnlFesdicegtrsrvuouesrdbpejaue6snctt(nheAaedn-siocntafo-ifbfoelrds exhibited uniform coverage, forming a network architecture characterized by consistent microporosity. These pores were supposed to serve as pathways for gas transport, thereby bolstering the material’s suitability for gas/VOC sensing applications. Sensors 2024, 24, 2174 deposition. However, following the dipping, analysis through both optical and scanning electron microscopy revealed that the fibers collected in denser networks (Figures 5A,D and 6A,B exhibited enhanced adhesion to the substrate (IDEs and SiO2 wafer, respectively) and maintained interconnectivity with one another, despite experiencing partial loss o1f0tohf e2i2r linear structure. FFiigguurree55.. OOppttiiccaall mmiiccrroossccooppeeiimmaaggeessddeeppicict tththeeddisitsrtirbiubtuiotinonofofifbfiebresrosnotnhethIDe EIDsEursfuacrefaicnebirnigbhrtifigheltdfMMt(ieiAoGlGd,nBCC;,()D(A)UBUV),V)B//Pas,PDhnEEodI)-IwMa-MSnsiGdOtGhC2SCeinOw(naP2aanVfnowePofira-fbMifsbeelrGeriscrsCescls)ioccUaoeVutasinetnudilgnenecgrtdthretoeflhrdueefeolleeurnlceoetasrcrnceoterosdoncfieedcbsneerfcsooe(uflClos(o,ClEwlco,)oE.iwan)t.SgiinSpnagpgece4abic-fimei4fcfi-aoicmnlralueylilnt:yde:ei(epAl(elpAe,cDict,nDtr)rgoo);sssps(hpChioinon)wnwndiinintstghhgpeelddae(ye(PpPpsVoVotsPhsPiie---t(ioPnV;P(-BM) GshCo)wUVsntahneo(fiPbVrPo-uMs lGayCe)rUfVroemlecatr3o0d-seencoanndofdiberpooussitcioona;tianngdb(eEf)oirleludstirpapteinsgth; (eCla) ydeirspfolallyoswtihneg (tPhVePd-eMcoGrCat)iUoVn nwainthofPibErIo-MusGlaCy.er from a 30-s deposition; and (E) illustrates the layer following the decoration with PEI-MGC. SEM images of Figure 6 (A-inset) proved that the individual nanofibers within the netwOoprkticeaxlhmibiictreodscionpteerspeiccttuinrgestroafjeFcigtourriees5,Bc,rCeaatnindgSpEoMinmtsiocrfocgornatpahcst aonf dFipguotreen6ti(aAl -binosnedt)thlbifaaisirohnonnitrslgerdtagleuhojhdafutibwclrhiFbniTTTteagaeuiiecthhhtnghrrtwirpeeeiugrosatoasso,enriladneennelel,ieyisnsngpcipsacm,nreta5uhdapceemtAregdraaiegitrnnorgrsije,raDaasgsgecinetcselchds,ytlote-ctEy.atolenfctiioiSinrnoanattbofiuhngmklssfiunticetdaghabsnhiapgcnlneed6alcsecaeedrAtyolessixdhfaen,nr.b,iirBrtrbattgoeeaeyrn.ei,reiirnrTibdnob-eeestdhufsxronodspaiipttmthsvaehenoaeeageecntscetrpifrhootnsnlofeeeaiilesenbenudtpcichtlogttwopehoietn,omffaiofoananfonndroanlgrbgkaoiyrndroeamnsfieahelsuoPipcsnagaseftntEaotipimevhidbroIfiropt-iienueidMgbneartnalheenhslaGtlornletssaiffoitCnwgoosorojiherungfnedavttltnsanwleeelthtnichdaieprneontainreoigzrbeilootksenladyhnafiim.tttsnesieftbeotlh,deradefunarietbrobthgcashisorteee.lnhieeifrrnotdsnaseytcnc,phbedsesaeyeauniosbsndbcmfereodeijunftebsaewpmhtcsamtrtateeeiteiibrnureecodviurnccrnaoaheittlnEisobos.aocgtflnsTnUoOeutithphcioVHhcnaeeefhe-l Sensors 2024, 24, x FOR PEER REVIEWpsitcrteunrgesth(Foifguthree 5tChr,Eee)-odfima leonossieornmalessthruncettuwroersk, wbehfiolreeaalnsod ianftcerreadsiipnpgintgh.eIanvdaeieldab, lteh1e1sufoirbffea2r2cse eaxrheiabwiteidthaandosotarbplteiobnrisgihtetsn.ess, leaning towards a green hue (Figure 5C). sFsFeiuigqgbuuusreerenqet6u6P.e.SEnEItS-MPMEEMGmI-CMimcrdGioceCgrcorodagrperacahtoipsorhndastetiphodnirecopttuhificgrbtoheufdrigbsihpeorpfdsiPinpoVgpfPi(PnA-VMg)P,(GAa-MCl)o,nGaagflCtoewnragiUftthweVrai–tUlhmigVaah–gmtlniiagirfigrhaentddifiiirvaertidaieodwvniiaeo(twAifoa-noinsfe(saAectts-)ieioancnnstied(otB)ns)ua.(Bnbd-). TMheorenoovrmer,alwizheedn dciosatrteibduwtioitnh oPfEIthoeligfiobmererdsimanednsMioGnCisnraenpooprotewddeinr, FPiVgPurnea7n.ofTibheer glurampihnsosshitoywinttheantsipfireidorftuortchoeart,iancgc,otmhepnananieodfibbyeras eshxhifitbiinteedmaisrseiloanti.vUelnydnearrrthoewflaunodrewsceelnl-t defined distribution of diameters, as depicted by the Gaussian curve in Figure 7 (left), with a mean diameter of 168.10 nm and an SD of 44.97 nm. However, after dip-coating with PEI-MGC, the average diameter of the nanofibers increased due to the addition of the material onto the surface of the nanofibers (Figure 7, right). Both the flattening and broader shape of the Gaussian curve highlight a wider range of diameters within the SeSnesnosrosr2s022042,42, 42,42, 1x7F4OR PEER REVIEW 111o1fo2f 222 optical microscope, the presence of a thin, radiant coating on the fibers was clearly observable (Figure 5E) due to the bright blue fluorescence of PEI [62] confirming the dipping deposition. However, following the dipping, analysis through both optical and scanning electron microscopy revealed that the fibers collected in denser networks (Figures 5A,D and 6A,B exhibited enhanced adhesion to the substrate (IDEs and SiO2 wafer, respectively) and maintained interconnectivity with one another, despite experiencing partial loss of their linear structure. SEM images of Figure 6 (A-inset) proved that the individual nanofibers within the network exhibited intersecting trajectories, creating points of contact and potential bonding between adjacent fibers. These intersections contribute to the formation of junctions, thereby enhancing the structural integrity of the three-dimensional nanofiber network. The increased complexity of the network is evident in the emergence of features such as junctions, cross-linkages, and overlapping segments of nanofibers. ssFterigqeuunreTgenhtt6heP.soSEeEfI-MctMhhGmearCitcahrdcroteegecerro-airdspatihtimicsosndeneatphsrireicootunefigxabhpleesdrstcirptouepfdciPntVugtoPr(eA-Mbs),o,GwalsClohtenairlgfetetwrahilUetshoVoa–vilmniegcrahragetlnaliirsfirsiaetnaddgbivaittiliheiotwenyao(aAvfnaa-idinslesamecbtt)ileoeacnnhsd(uaBsrn)uf.iabcca-el area with adsorption sites. TThheennoormrmaalilzizeedddidsitsrtirbiubtuiotinonofotfhethfiebefirbdeirmdeinmsieonnsiiosnreipsorretepdorinteFdiginureFi7g.uTrhee7g. rTaphehs sghroawphtshsaht opwriothr atot pcroiaotrintog,ctohaetinnagn, othfiebnerasneoxfihbiebristeedxhaibreitleadtivaerleylantaivrerolywnaanrrdowwealnl-ddewfienlle-d ddiestfirnibeudtidoinstroifbduitaiomneotefrdsi,aams edteeprsic, taesddbepyitchteedGbayutshseiaGnacuusrsviaenincuFrivgeurine 7Fi(gleufrte),7w(liethft)a, wmiethan daiammeeatnerdoiafm16e8te.1r0onfm16a8n.1d0annmSDanodf a4n4.9S7Dnomf .4H4.o97wnevme.r,Haoftwerevdeipr,-caoftaetrindgipw-citohatPinEgI-MwiGthC, tPhEeIa-MveGraCg,etdheiamaveetreargoefdthiaemneatnerofoibf etrhseinncarneoafisebderdsuinectroeathseedaddduietioton tohfethaeddmitaiotenrioafl othneto tmheasteurrifaalceonotfothtehenasnuorffiabceerso(fFtihgue rnea7n, orifigbhetr)s. B(Foitghutrhee 7fl,atrtiegnhitn).gBaontdhbtrhoeadflearttsehnaipneg oafntdhe Gbarouasdsiearnschuarpvee hoifghthlieghGtaauwssiidaenr rcaunrvgee ohfigdhialimghettearswwiidtheirnrtahnegceoaotfeddinaamneotfeibrserwpiothpiunlatthioen (c∅o:a3te1d6.n70an±ofi1b5e1r.8p5onpmul)a. tIinodne(e∅d: ,3d16u.r7i0ng± t1h5e1.d85ipnpmin)g. Ipnrdoeceeds,s,dtuhreinfigbtehres tdriapnpsiintigonperodcfersosm, stmheoofitbherasntdraunnsiiftoiornmedsufrrfoamcessmtooosuthrfaancedsuandiofornrmedswuriftahcerosutoghsusrlefaecveessa. dTohrins etrdawnsiftohrrmoautgiohn ismlepeavretse.dTahiws rtrinankslefodrmapaptieoanraimncpeatrotetdhea fwibreinrskalenddaipnpcreeaarasendcebtooththtehefiibredrsiaamnedteinrc(r+e1a8s8ed%) abnodthhethteeriorgdeinaemiteyteirn (s+h1a8p8e%()Fiagnudreh6eAte,rBo)g.eAnseiatyreisnuslth, athpee n(Faingoufribee6rAs p,Br)e.sAensteadrecsluusltt,erths eof pnaarntiocfiublaetresmpraetsteenr tdeidstcrliubsutteerds oalfopnagrttihcueilratleenmgathttewridthistdriifbfeurteendtasluornfgactehediernlesnitgieths bwuitthfirdmif-ly afderheenrtinsgurtfoactheedfeinbseirtidesuebutot fithrme plyreasdehnecreinogf PtoEIth. e fiber due to the presence of PEI. FF(irigigguuhrrete)7. 7.T.NhNeoorxmr-amaxlaiiszlierzdeepddriedsstiersintbrtuisbttiuohtneioronafnNogfFeNdoFifanmdaienatmoefiresbtoeefrrsPdVoiafPmP-MeVtGPer-CsM;(tGlheCfet)y(a-laenxfdti)sParVenPpd-rMePsGVenPCt-/sMPthGEeIC-pM/PrGoEbCIa-Mb(riiGlgithCyt). Tdheenxs-itayxiosfrnepanreosfiebnetsrsthaet eraacnhgedioafmneatneorf.iber diameters; the y-axis represents the probability density of nanofibers at each diameter. 33.2.2..SSeennssiinngg EElleeccttrriiccaall CChhaarraacctteerriizzaattiioonn MMGGCCDDaauusseeaattcocoooPnnPVddVuPuPcctntniivaavenneofiofffiliillbeblereerrrisssi’’seixiennpxtterrpciienntcesstdiieccdtopptooeoonorehrnaeehnlleeacccenttrctriheicceaatlholveccoeoornnvaddleluruecacltletilvicvetirtliyeticyca[tl6[r6i3cc3o]a,]nl,tdhctuhoecentadiadvudditcdiyttiiitovoifointtnyhoeoof ff tchoemcopmospitoesimteamteraitaelr.iaFli.gFuirgeu8reA8,BA,iBlluilsltursattreastetshethceucrurerrnetn/vt/olvtaoglteag(eI–(VI–)Vp)loptloftofrorthteheIDIDEE pcdcoloeoaanttteoeddtdeenswwotiihtttehhesPaPtpVhVpePPl-i-aMeMpdGpGvlCiCoelndtnaaagvnneooofilatfbacirbegoreessrsasbctebhrfeooefsroeserleatehcntaedrnoeaddlfeetaec,frtrtraeUonrdVgUeip,nVhrgaopfntrhogocoimuntorgi0cnuftgrroo.inmT2ghV.e0, xTtwo-hahex2iilxseV-o,tahfwxetihhsyeio-lpeafxlttoihhstee SSeennssoorrss 22002244,, 2244,, x21F7O4R PEER REVIEW 1212oof f2222 rye-parxeiserneptsretsheentcsutrhreencut rpreansstipnagsstihnrgouthgrhoutghhe tehlecetlreocdtreo.dAe.sAths ethveovlotaltgaegeisisininccrreemmeennttaalllyy rraaiisseeddininththeeppoosistitvievedidreircetciotino,nb,obtohtIhDIEDsEesxhexibhiitbaitlianelianreianrcrienacsreainsecuinrrceunrtr,ecnhta,rcahcaterraiczteedrbizyedcobmypcaormabplearsalobpleeslo(≈p2e3sM(≈O2h3mM).OAhmve)r.yAslvigehryt isnlcigrehatsiencinreealseectirniceallecrtersiicsatal nrecseisistaonbc-e siesrovbesderwvheednwPhVePn-MPVGPC-MnaGnCofinbaenrosfaibrerUs Var-eirUraVd-iiartreadd(iaPtVedP-(MPVGPC-)MUVG, FCi)gUuVr,eF8iAgu. rIet c8oAu.ldIt bceouatltdribeutaetdtrtiobuthtedalttoertahteioanltoefrtahtieonnaonfofithbeernsatnruocfitbuerre sintrduucctuedrebiyndphuocetodobxiydpathionto/corxoisdsa-ltiinokni/ncgr,olsesaldininkgintgo,clheadnignegs tino tchheancognesduincttihveitycopnadtuhwctiavyistywpitahthinwtahyesnwanitohfiinbetrhneentawnoorfkiboerr innectwheomrkicoarl/ipnhcyhseicmaliccahla/npgheyssiocfatlhcehPanVgPe-sMoGf tCheinPteVrPfa-MceG. C interface. Figure 8. I/V measurement of the nanocomposite fibers before (PVP-MGC) and after the UV treatMmFUieGVgnuCttr)reUe(VPa/8VtPm.PEe-IM-nIM/tGVG(CPCmV)U(PVeB)-a)Ms.(uAGre)C;m)UceoVnm)t p(oAafr);itshcoeonmnbpaenatrowicseooemnnpbotehsteiwteeIe–fnVibethcruservbI–eeVsforcoeuf r(v(PPeVVsPPo--MfM(GPGVCC)P)U-aMVnGdanCda)fUte(VPr VatnPhd-e (PVP-MGC)UV/PEI-MGC (B). urfitcgdmaohonricuseanpiitfrsplslroieiiHhtiHgsrebaietmsrostueonaetnwtwlnephseytoehadecnedvvotelasieietennnnishcgrrseotst,,enririfttsrdinihiihcbtebfeaeeaieuecinnlltsrtalihcotseinnnonefiedewotnelbafeidaeiisrenctbnriuhrstgseersschiinrnirhdtascwigiavepafitayhpiilectnttecheyhabodoenariboannatrtscbfihnrderestiboargnuehevesterrecesretvtrosahdtirgehvtfeaadyiei0tnnncthbieygdoVtnenahenatrtteaitchihronanrrciaeeftceoduettrl0csrret+bsurafhneVa2etrtgenchtrtVwtehteaech/.nneoesevatdnuTein/onnntvghtlda+titogiefrac2svielergtbtsofuVaelbeatlegnsureccnsseiuettmfugwh.oarctgeTvanurehtgemhoderMaevfniossentefdthGlfiudtseioehbsnCcfvttenetirhtorfmraPihooablsnVuedrtauaommPyePMtnfis/iVobdebdGmineePmoieCsre/uflfstpmseart.nomhlcicFiiebptfieeusrlaouosioonryrttrttadmpaiohhotbneoueealnesy--srst, oitfipbreerssu. mFuarbtlhyeirn, diticparteessuemffeacbtliyveinindtiecgartaetsioenffeocfttihvee cionntedgurcattiivoenmofattehreiaclownidthuicntitvheempoaltyemriaelr wmiathtriinx,thenespuorliynmg eerffmiciaetnritxe,leencstruornintgraenffispcoiernt tpealtehcwtraoynst.rTanhsepionrttegpraatthiownayosf.tThheseeinntaengorfaitliloerns owfatsheaslseoncaonnoffiirlmleersdwbyasthalesoTEcoMnfiimrmageedsb(yFitghuereTE4DM).iGmraagpehse(nFeig, buerein4gDa).hGigrhalpyhceonned, ubcetiinvge amhaitgehrilayl,coconudludctiinvteromdautceerina-lt,ycpoeulddoipnitnrogdcuhcaeranc-tteyrpisetidcosptointghcehcaormacpteorsiistteicnsatnootfhibeecrosm. Tpho-e spirteesneannceofiobf edresf.eTcthseopr rfeusnecnticoenoafl dgreofeucptss oonr ftuhnecgtrioapnhalengerosuuprfsaocenmthaeygdroanpahteeneelescutrrofancsetomtahye dPoVnPatmeaetlreixc,trloeandsintogtthoeaPnVexPcmessatorfixn,elgeaatdivinegchtoaragne ceaxrcreiesrsso(felneectgraotnivs)eacnhdarrgeseucltairnrgieirnsn(-etlyepc-e tsreomnsic)oannddurcetsourlbtienhgavinionr.-tIynpteerasectmioincobnedtwuceteonr tbheehPaVviPorp. oInlytmerearctaionnd bgeratwpheeennethmeePsoVpPorpooul-s ysmtruecrtaunredsgmraapyhfaecnielitmateescohpaorrgoeutsrasntrsufecrtuprreoscemssaeys.facilitate charge transfer processes. TThheePPEEII--MMGGCCddeeccoorraattiioonnoofffifibbeerrsstthhrroouugghhddiippppiinnggssiiggnniifificcaannttllyybboooosstteeddsseennssoorrccoonn-dduuccttiivviittyy(R(R≈≈343k4OkhOmh)m, w),hwilehimleamintaaiinntianingianlginaealirnreealratrieolnasthioipnsbheitpwbeeetnwtheeenapthpelieadppvloiletdavgoeltaangde tahnedmtheeasmureeadsucruerdrecnutr(rFeingtu(rFeig8Bu)r.eT8hBe).inTsheet ginrasepthgirnapFihguinreF8igBuirseid8eBnitsiciadletnotitchael otonethdeeponiceteddeipnicttheedsianmtehefigsaumree, efixgcuerpet,feoxrctehpetyfo-arxtihs,ewyh-aixchis,iswphriecshenistepdreinseanltoegdairnitahmloigcsacrailteh.mTihcisscaadljeu.stTmheisntaednjuasbtlmesetnhteevniasbulaelsiztahteiovniosuf aIVlizcautirovnesosfimIVulctuanrveeosussliym. uSlutcahneaonuisnly-. cSruecahseainn icnucrrreeanste iisnpcruersruemntabislyprdeuseumtoatbhlye oduuteertoMthGeCobuetienrgMaGblCe tboeipnrgovaibdlee taoddpirtoiovnidael caodnddiuticotnivael cpoantdhuwcatyivsewpiatthhwthaeyns awniothfibthere nanofifilbler naentwofoirllke.rPnEeItwmoaryk.fPuErtIhmerayimfuprtohveer eimlecptroicvael ecloenctdruiccatlivciotnydbuyctpivroitmy obtyinpgrobmetotetirndgibspetetresriodnispanerdsiaodnhaensdioandohfetshioenmoef stohpeomroeusosgproarpohuesngeraopnhtoenteheonntaontohfiebnearnmofaibtreirx.mAadtrdixit.ioAndadlliyti,otnhaelldy,etchoeradteioconrwatiothn mweitshopmoersooupsogrorua-s pghraepnheeannedanPdEIPcEoIucloduilndcirnecarseeasthe ethseusrufarcfeacaeraeraeoafotfhtehennananoofifbiberesr,s,pprorovvididininggmmoorree aaccttiivvee ssiitteess ffoorreelelecctrtroonntrtarannsfsefre.r.ThTihsiisnicnrecaresaesdedsusrufarcfeacaereaareias eisxpeexcptedctetod ftaociflaitcaitleitaatebeattberetitne-r tienrtaecrtaicotniobnebtweteweenetnhtehneannaonfiobfiebresrasnadndthtehesusrurroruounnddininggenenvvirioronnmmeennt,t,leleaaddininggttooeennhhaanncceedd sseennssiinngg ppeerrffoorrmmaannccee..FFuurrththeerrmmoorree, ,PPEEI,I,kknnoowwnnffoorriittssaabbiilliittyyttoopprroommoottee cchhaarrggee ccaarrrriieerr mmoobbiillity [64], ccoouullddccoonntrtribibuutetetotothtehemmovoevmemenetnotfoefleecltercotnrsonthsrothurgohutghhe tnhaennofainboerfinbetrwnoertk-. work. Sensors 2024, 24, 2174 13 of 22 To evaluate the sensing features, we subjected both (PVP-MGC)UV and (PVP-MGC)UV/MGC- PEI sensors to airflow under conditions of constant temperature and relative humidity. Each measure was carried out to detect various common solvents and chemical compounds that could potentially interfere with the sensors and might be commonly encountered in environments of laboratories and industries. For these measurements, defined amounts of fluxes were partialized and controlled to generate the necessary concentrations of the desired target vapors. Upon exposure to each VOC, both the sensors demonstrated an increase in current. However, the responses of the (PVP-MGC)UV/MGC-PEI sensor were notably faster, as expected, and more reproducible than (PVP-MGC)UV, presumably attributable to the im- proved stability conferred by the addition of an outer skeleton of a mixture of nanopowder and oligomers, i.e., MGC and PEI, respectively. For each of the VOCs tested, (PVP-MGC)UV/MGC-PEI sensor detected up to eight concentrations, starting from their saturated vapor pressure. From these measurements, variations in current corresponding to vapor concentrations were observed in the sensor output. The graph in Figure 9A depicts a comparison of the sensor’s transient responses upon exposure to different tested VOCs. These responses are calculated as the ratio between the Sensors 2024, 24, x FOR PEER changes in REVIEaWcetic acid measurement current (∆I) (HAc) (at a concentration and the baseline of 30 ppm), the current current e(Ix0h) iobviteerdtiamrea.pNidotianbc1lr4ye,aofsfoer2,2 stabilizing at t90 = 90 s, i.e., the time it takes for the sensor to reach 90% of its final stable response. FFigiguurere9.9.NNoormrmaalilzizeeddtrtarannsiseiennttrerespspoonnsseess(∆(ΔI/I/II00) towards the highest concentration of VOCs meas-sured (HAc: 3300ppppmm,,FFAA: :44400ppmpm, N, NHH3:37:5745p4ppmp,mM, eMOeHO:H22:4252,4E5t,OEHtO: 9H3:09p3p0mp,pAmc,: 4A1c2:64p1p2m6 p, TpEmA, : T1E3A4:91p3p4m9 p, BpumtA, B: u16tA91: p16p9m1)p(pAm) a)n(Ad )naonrmd anloizremdarleizsepdonrseespcounrvseescpulrovtetesdpalogtatiendstaignacirnesatsiinncgrceoansicnegncotrnacteionntrsa(tpiopnms )(popf mVO) oCfsV(BO)C. s (B). CTohnevberasreplyl,othien sFeingsuorre d1i0ddneopticrtesvgeraelaatnerydseigtaniallotfothalel sthenesoitihveirtyVvOaClusesatoefqthueivsaelnensotr cotonctehnetrteastitoendsV. HOoCws.evInero, irtdiesrntootebweoarbthleyttohadtitshpelaseyVaOll Cvsalgueense, rtahte vya-arxyisngwcaosnfcreangtmraetinotnesd. inThpearstesnpseorrmexilhliobnits(pmpimni)maat lroseonmsiteivmitpyetroatpuorleadr uanedtosmdiafflelrceonmcepsoiunntdhseilrikpeaertihaalnporles(EsutOreHs.) Tahnuds, mtheethtraannoslie(nMt emOeHas)u. rHemowenetvseirn, iFtisgsuernes9itAivditeysctroibaemaincoems, preagriasrodnleosfsreosfptohnesiresstarmucotnugre d(ipffreirmenartyc,osnecceonntdraatriyo,nolrevteerltsi.aIrny)t,haencdastoe okfetfonrmesicisanciedgl(iFgAib)lteh. aTthhisaseffaevcatpcoorupldrebsesudrueeotfo 4t.6h6ekmPeas(oHpAorco, uPvsaspt:ru1.c5t4ukrePoa)f cthalecushlaetlel,dwbhyiAchnetonianbeleEsqsuealteicotniv[e65p]e, rthmeesaebnisliotyr .dIetmcoounlsdtraaltleodw asdmisatlilnerctminoclerceuaslees,insuccuhrraesnHt wAcheanndexFpAo,steoddtioffuapseptrhorxoimugahtewlyh4il4e0epxcplmud, ianlgthloaruggehr wmiotlheslcouwleesr. kinetics and without reaching apparent equilibrium within the same exposure time defineAddvdsi.tiaolnl athlley,VtOheCsse. mTheesorepfoorrees, VmOaCy pmrolveicdueleasnadexsoternbdededonsutorftahce naarenao,coenmhpaonsciitneg fitbheerisr, ibnytecrhacatniogninwg itthhetchheafrugnecdtiostnraibl ugtrioounp, sleadntdo ianncrienacsrienagseaidnsocorpntdiounc.tiTvhitey.pHreoswenecveero,f dPesEpIiitne tbheeinsghemlle, ainsturroedduactincgonacmenintroagtiroonusprsanabgliengtofrfomrmhhuynddrroegdesntobothnodusswanitdhstohfepcparmb,oanlyl l ogthroeruVpsOoCfsHmAinc iamnadllFyAin, cflouuelndcefadctilhiteacteurtrheenstevlaecritaivtieoand, asosraplstiooncoonffitrhmeseedcianrFbiogxuyrleic9aBc.ids. The combined effects of the surface chemistry and pore structure result in increased sensitivity to acetic acid. Additionally, at higher concentrations, the enhanced diffusion of formic acid FA molecules through the shell leads to detectable levels of formic acid FA adsorption, expanding the detection capabilities of the sensor. Furthermore, the significant increase in current observed during the interaction between HAc molecules (acting Sensors 2024, 24, 2174 14 of 22 On the other hand, the sensor response size and shape to HAc suggested rapid and selective detection of the target analyte, which is essential in applications where realtime monitoring or quick identification of substances is required, such as environmental monitoring or industrial process control, where delays in sensor response could result in missed events or inaccurate readings. Moreover, the rapid response time correlated with the highest response signal enables the sensor to detect even low concentrations of analytes quickly. This is vital for ensuring the sensor’s effectiveness across a wide range of concentrations and for detecting trace amounts of acetic acid. The graph depicted in Figure 9B showcases the correlation between normalized sensor responses and increasing concentrations of VOCs, spanning from 0 to 4125 ppm. Each concentration interval aligns with the sensor’s sensitivity, delineating clear and discernible data points across the graph. All curves exhibit linearity across the tested concentration range. Particularly noticeable is the response curve for acetic acid, which stands out by overlapping the y-axis at lower concentrations (as depicted in the Figure 9B inset), underscoring the sensor’s heightened sensitivity to acetic acid compared to the other tested VOCs. The slope of each curve acts as a sensitivity metric, further emphasizing the sensor’s strong affinity for the analyte. Sensors 2024, 24, x FOR PEER REVIEW Among the tested VOCs, FA emerges as the sole compound significantly impa15ctionf g22 sensor responses, albeit at elevated concentrations. The bar plot in Figure 10 depicts greater detail of the sensitivity values of the sensor to theTtehsetesdenVsoOrCwsa. sInteostredderfotroobneeambloenttoh daitstphleaysaamllevcaolunceesn, tthraetiyo-naxoifsawceatsicfraacgidmteonetvedal.Tuhaetseeintssosrtaebxihliibtyitsovmeirntimimael s(eFnigsuitriveit1y0Bto).pTohlaerraensdposnmsaell((cΔoIm/Ip0)omueann:d2s.9li4ke±e0th.1a5n),olav(EetrOagHe)d (atapowfdlnrlraodtoiihytmwmhmesiasnfimeormtyvfthe,heausaselomsnleeeprcoera.oolanmTnr(sgoMhduoeuearleseoerOsmycfse,utHtnerholnues)er.ostcsm,tHrteusspreouretdaewcirsaehoudemrfyvaraoes)ety,hmnr,H,aeseeintAxtnsrdshahcttiseetbaeelordnilnrt,dekoswadireFt.thicAroveeinci,rpthtetyraosoeitnddinosiuasfanbfctmuaielbebsgiisenillliiesitgtthyesyi,blr,(eorl(ceweΔut.gigIiva/tThIher0hd)wpmflilseeehuasrenicsml:ftef2uoee.ea9fcaxtt1btichoci±llueoni0itudsry.1li.rsdn9etIg)rmtbualceaafcotitrdenuugruilrend3eerg0 molecules. Figure 10. Sensitivity of the sensor towards each vapor solvent (A); sensor responses to 15 ppm HAc in 30 days (B). Figure 10. Sensitivity of the sensor towards each vapor solvent (A); sensor responses to 15 ppm HAc in 30Addadyisti(oBn).ally, these mesopores may provide an extended surface area, enhancing their interaction with the functional groups and increasing adsorption. The presence of PEI in the sheTlal,bilnet1ropdruocvinidgeasmaicnoomgproruehpesnasbilveetovfoervmiehwydorfotgheenkbeoyndsesnwsiinthg tahtetrcibarubtoesnyolfgvraoruiopuss onf aHnAosctrauncdtuFrAed, cohuemldirfeasciislittoartsedtheveesleolpeecdtivoeveardsthoerpltaisotndoefcatdhe,seinccalurbdoinxyglitcheacsiednss.oTr hdeecovmelobpineeddinefftehcistssotuf dthye. Istusrpfaecceificchaelmlyisctormy panadreps oserensotrruwctourrkeirnegsuteltminpeinractruearesesdansednlsimitiivtistyof todeatceectticioanc,idth. eAkdedyitpioanramllye,taetrshiagffheecrticnognceennetrrgaytioconns,stuhme pentihoannacned dseifnfusistiovnityo,frfeosrpmeicctiavceildy. FA moSleencsuolress othpreorautginhgthatehsihgehlel rleteamdspteoradtuetreecst,adbelseplietveetlhseoirfbfororamdicraancgide oFAf daedtescotriopntioand, efxapsatnredsipnogntshees,dmetaeyctnioont bceapoapbtiimlitaiel sfoorfwtheearsaebnlseoarp. pFluicrathtieornmsodrees,igthneedsigtonmifiocannittoirnhcarezasredous pollutants for workers. This is primarily due to their increased energy consumption, leading to a shortened battery life and necessitating more frequent recharging or replacement, which may not be practical for continuous use. Moreover, higher operating temperatures can expedite material degradation and necessitate additional thermal management systems to maintain stability and safeguard sensitive components. Consequently, the Sensors 2024, 24, 2174 15 of 22 in current observed during the interaction between HAc molecules (acting as Lewis’s acids) and the MGC-PEI outer layer (with Lewis base sites) could result from the transfer of electrons from the Lewis base sites to the HAc molecules, thereby enhancing current flow. Additionally, the protonation of PEI molecules by acetic acid may modify the charge distribution within the composite, consequently increasing conductivity. An estimation of sensor selectivity [66] among the tested VOCs is calculated as follows: Sel(Ak) = ∑j i=1 S(Ak)/S(Ai) × 100, where Sel is the selectivity, S the sensitivity, and A is the analyte, which reveals that the sensor exhibits 96% sensitivity to acetic acid, 3% to formic acid, and 0.2% to ethanol. The other values are negligible. The limit of detection (LOD), often defined as the concentration at which the signalto-noise (S/N) ratio equals a 3 (LOD = 3 × Baseline Noise), represents the concentration at which the signal becomes three times higher than the baseline noise, ensuring reliable detection above the noise level. In our measurements, conducted up to 950 ppb, the LOD was determined to be 160 ppb (Figure 9A). The sensor was tested for one month at the same concentration of acetic acid to evaluate its stability over time (Figure 10B). The response ((∆I/I0)mean: 2.94 ± 0.15), averaged from five measurements per day, exhibited reproducibility ((∆I/I0)mean: 2.91 ± 0.19) after 30 days of use. The sensors demonstrated a certain stability, with fluctuations remaining within the range of the measurement error. Table 1 provides a comprehensive overview of the key sensing attributes of various nanostructured chemiresistors developed over the last decade, including the sensor developed in this study. It specifically compares sensor working temperatures and limits of detection, the key parameters affecting energy consumption and sensitivity, respectively. Sensors operating at higher temperatures, despite their broad range of detection and fast responses, may not be optimal for wearable applications designed to monitor hazardous pollutants for workers. This is primarily due to their increased energy consumption, leading to a shortened battery life and necessitating more frequent recharging or replacement, which may not be practical for continuous use. Moreover, higher operating temperatures can expedite material degradation and necessitate additional thermal management systems to maintain stability and safeguard sensitive components. Consequently, the complexity and associated costs of thermal management diminish the appeal of sensors operating at higher temperatures for wearable devices. Conversely, room-temperature chemosensors offer advantages such as simplicity, ease of use, and reduced energy consumption. However, they may encounter limitations related to sensitivity, selectivity, response time, susceptibility to environmental interference, and sensing material stability. To address these limitations, as elucidated in the Introduction paragraph, integrating graphene (RGO or G) with metals [32] or ceramics [33] has enabled chemiresistors to operate effectively at room temperature, achieving remarkable sensitivity with detection limits of up to 1 ppb [34]. The chemosensor developed in this study, consisting of electrospun PVP nanofibers filled with MGC and coated with PEI and MGC, demonstrates several competitive characteristics (Table 1). It exhibits sufficient sensitivity to detect low concentrations of the target analyte (LOD: 160 ppb) at room temperature, rendering it suitable for monitoring in various industrial or occupational settings. Moreover, the sensor displays high selectivity, with a specificity of 96% to acetic acid, enabling accurate discrimination of acetic acid from other gases or vapors in the environment, thereby minimizing false positives and ensuring precise detection and monitoring of acetic acid levels. Furthermore, the chemosensor demonstrates strong stability over an extended period, maintaining consistent performance over 30 days of continuous measurements. This longterm stability ensures reliable and sustained operation of the sensor, reducing the need for frequent recalibration or maintenance. The fabrication process for the chemosensor Sensors 2024, 24, 2174 16 of 22 Sensing Material Pr-doped ZnO Y-doped SnO2 Ag-doped LaFeO3 Flower-like SnO2 CdSxSe1−xnanoribbons Gr:Au and Gr:Pt Hexagonal ZnO Tb2O3@MOF- ZnO Bi2O2CO3 Co-doped SnO2 metal oxide (WO/SnO) Sn3O4-RGO C-doped α-Fe2O3 Y-doped ZnO mesoporous CuO BaSnO3 microtubes ZnO foam GeC3N4 e SnO2 MgGa2O4/graphene In2O3 nanofibers Mg-doped ZnO/rGO GQDs–ZnO PVP-MGC/MGC-PEI is straightforward and easily implementable, making it accessible and cost-effective for large-scale production. Table 1. A summary of recent research on gas sensors for the detection of acetic acid. Type of Sensor Chemiresistor Chemiresistor Chemiresistor Chemiresistor Chemiresistor Chemiresistor Chemiresistor Chemiresistor Chemiresistor Chemiresistor Chemiresistor Chemiresistor Chemiresistor Chemiresistor Chemiresistor Chemiresistor Chemiresistor Chemiresistor Chemiresistor Chemiresistor Chemiresistor Chemiresistor Chemiresistor Temperature (◦C) 380 300 150 260 100 rt 230 20 ◦C 150 ◦C 300 ◦C rt rt 260 ◦C 350 ◦C 200 ◦C 245 ◦C 400 ◦C 185 ◦C rt 250 ◦C 250 ◦C rt rt LOD 50 ppm 10 ppm 0.5 ppm 1 ppm 0.87 ppm 0.6%/ppm 10 ppm 0.5 ppm 1 ppm 10 ppm 30 ppb 64%/ppm 1 ppm 10 ppb 10 ppm 0.3 ppm 0.5 ppm 0.1 ppm 1 ppb 500 ppb 10 ppm 1 ppm 160 ppb Reference [13] [25] [67] [24] [68] [69] [16] [17] [70] [71] [18] [32] [72] [12] [31] [15] [73] [74] [34] [21] [33] [30] - 3.3. Portable Sensing System Refocusing our attention on the human risks associated with exposure to hazardous concentrations of acetic acid, often challenging to measure in workplace environments, direct tests of this sensor using the previously described portable sensing system were carried out to assess its efficacy and practicality. As depicted earlier (Figure 2B), unlike the stationary system, where output is measured in current (A), the portable measurement system delivers output signals in voltage (V). The sensor’s interdigitated electrode (IDE) was connected to a dedicated electronic circuit board to ensure dependable measurements and housed within a Teflon measuring chamber installed on the board. Purified ambient air at 20 ◦C (±1 ◦C) and 45% relative humidity (±5%RH) was employed as the gas carrier, replicating realistic ambient conditions for these assessments. Each measurement was carried out for a duration of up to 90 s to ascertain if this timeframe allowed the sensor adequate time to detect the presence of acetic acid in the environment. Therefore, a sequence of progressively increasing exposure concentrations within 7 and 47 ppm, was generated and directed into the measurement chamber to evaluate the sensor’s linearity and sensitivity (refer to Figure 11). After each exposure, the sensor was purged with purified ambient air only, facilitating the desorption of acetic acid from the sensor surface and restoring its original conductivity. Based on the maximum signal attained, a calibration curve was derived (Figure 12). SSeennssoorrss 22002244,, 2244,, x21F7O4R PEER REVIEW 1717oof f 2222 Figure 11. Normalized (ΔV/V0) response–recovery curves of the sensor when exposed to increasing concentrations of acetic acid vapors, ranging between 7 and 47 ppm. After each exposure, the sensor was purged with purified ambient air only, facilitating the desorption of acetic acid from the sensor surface and restoring its original conductivity. cFFcoioigngnuuccereennTBt1tahrr1asae.tetiNirNdooanononosrsrgmnmooefaftahelalaincezceeecmttdoiiccma(aΔ∆axpccViiimadd//sVuVvsv0aema)0ps)preoroasesrrilpssgslp,,otnrorhnaaansenlnsegcgae–io–itrnnternagegcciconbeboveneevettdetrwwrry,ayeeacteecuinncourarnv77lvesiaaebsnunsroddnaofftd44tiht7o7ehernppescppsceomemunnnsr..ssovoiredrwewwrhhaaeestninodeenexxr,ppirovoesesseeduddl(tttFoioniigignnuccirrnreeeaaa1ssil2inin)ngg.ear fit curve (red) with a slope of 0.01033 ppm−1. After each exposure, the sensor was purged with purified ambient air only, facilitating the desorption of acetic acid from the sensor surface and restoring its original conductivity. Based on the maximum signal attained, a calibration curve was derived (Figure 12). The range encompasses all the concentrations under consideration, resulting in a linear fit curve (red) with a slope of 0.01033 ppm−1. FFiigguurree1122. .NNoromrmalaizliezdedvovltoalgteagrespreosnpsoens s(∆esV(/ΔVV0)/Vto0)dtioffedreiffnteraecneticaacceitdicvacpiodrsvcaopnocresntcroanticoennstr(patpimon)s. (ppm). The range encompasses all the concentrations under consideration, resulting in a linear fit curTvhee(rinedte)gwraithioan solof ptheeofse0n.0s1o0r3i3nptopma −p1o.rtable and low-cost system has reduced the sensiTtihveitiynotefgtrhaetisoennsoofrt,haechseienvsionrginat1o pappmorLtaObDle aanndd alo3wp-pcomstLsOysQte(mlimhiatsorfeqduuacnetdifitchae- steionnsi)t.iLviOtyQorfetphreesseennstosrt,haechloiewveinstgcaon1cpepnmtraLtiOoDn aacncduraa3teplypmquLaOntQifi(albimleitboyftqhueasnetnifsiocartwiointh). FLaiOnguQarcecre1p2.traeNbsoelernmltesavltiezhleedolfovpworletacsgitsecioorennscpaeonnndtsreaasctci(ouΔnrVa/acVcy0c)[u7tro5a]td.eilffyerqeuntanatcieftiiacbalecidbyvatphoerssecnosnocrenwtriatthioanns (apcpcmep).table level of precision and accuracy [75]. 4. Conclusions 4. CoTInnhceltuhinsisitoesngtusradtyio, nwoefetxhpelosreendsothr einsteonsainpgorptraobpleeratnieds loofwa-ficobsrtousyssmteamt choams prerdisuincgedPVthPesMenGsiCtIinvditethyciosorsfattuehddeysw,ewnitsehoerPx,EpaIlc-ohMrieeGdvCitnhgaenasde1ndpseippnmogspiLtreOodDpoearntniadensaoI3Df aEpp.fimPbVroLPuOsdQmem(altiomncositmroapfterqissuieanxngcteiPfillVceaPn-ttMsiopGnin)C.nLadObeiQcliotyrrea,ptyeridelsdweinnittghs tuPhnEeiIfl-oMrwmGesnCtacanonondficbedneertpsraowtsiioittnhedcaococnnutrraoanltleeIldDy mEqu.oParnpVthPifiodlaobeglmeyobanynsdtthrsaettrseuescntesuxorcree.wlTleihtnhits asunpnianifcnocarembpitilatitybyl,aeyllioeevwldesilnohgfoupmnroeifcgoiesrnimoenonuaasnndboifanibcdeciurnsrgawcsiyitthe[7cd5oi]ns. ttrriobluletdiomn,ocropnhtorilbougytinagndtosttrhuectruerliea.bTilhitisy uannidfoarcmcuitryacaylloofwthsehsoemnsoogre.nTehoeuUs Vbicnudriinngg soiftePVdiPstnriabnuotfiiobne,rscoanimtrsibtouteinnsgutroe tthhee rloenligab-tielirtmy 4as.ntCadboainlcictcyluursaaiconyndosf ptheerfsoernmsoarn.cTeheoUf Vthceurisnegnosof rPVdPenvaicneo,fibpearrstiaciumlasrtloy enfosur reetnhveirloonngm-teenrtmal TstoabeinIlinhtyathnaicnsedsbtpuoedtrhfyo,erwlmeecatnericxcepalolofcrtoehndedtsuheecntssioverintdsyienavgnicdper,sopepanerstriitncieugslafoeraflytaufofirerbsre,onbuvositrhomntamht eecnoinmtanlpearrpisapinnlidgcaPotiuVotPnes-r. MlayGeCrsdoefctohreatneadnowfiibtherPsEaIr-eMfuGnCctaionndaldizeepdoswitietdh MonGaCnnIaDnEo.pPoVwPdedre, mseorvnisntrgatdeusaelxrcoelellsenats sfipllienrnaanbdilistyu,ryfaieceldbiningduinngifoargmennt.anofibers with controlled morphology and structure. This unifoTrmheitymaelsloopwosrohuosmsotgruecnteuoruesobfinMdGinCg psirtoevdidisetsribabuutinodn,ancot natcrtiibvuetisnigtestofothreanrealliyatbeilaitdyasnodrpatciocun,ralecaydoifntghetoseennshoarn. cTehdesUeVnscinugrinsegnosfitPivViPtyn. aAndodfiibtieornsaalilmy,sthtoeehnigsuhrceotnhde ulocntigv-itteyrmof stability and performance of the sensor device, particularly for environmental Sensors 2024, 24, 2174 18 of 22 graphene facilitates efficient electron transfer, resulting in rapid and responsive sensing performance. The nanomaterial dimensions of the fibers, achieved through electrospinning technologies, provide a high surface area-to-volume ratio, further enhancing the material’s sensing properties. Initial measurements revealed a notable sensing response of the nanofibers to carboxylic acids, particularly towards acetic acid vapors. The thin shell of polyethyleneimine (PEI) and mesoporous carbon graphitized (MGC) on nanocomposite fibers (PVP-MGC) provides an ideal platform for the adsorption and detection of acetic acid and a minor response towards the detection of formic acid. This behavior can be attributed to its surface chemistry, with a well-defined pore structure allowing selective permeability and increasing the sensitivity of the target analytes. The developed (PVP-MGC)UV/MGC-PEI structure is a combination of nanoarchitectures, strategies, and technologies validated by literature focused on acetic acid detection. However, in this work, we introduce an original composite material made of electrospun nanofibers of PVP doubly decorated with mesoporous graphene, offering distinct advantages over traditional sensing materials and facilitating detection capabilities. Finally, the synergistic effects of combining PVP nanofibers, MGC, and PEI created a multifunctional sensing platform with enhanced performance characteristics. This synergism led to improved detection limits, fast response times, and good stability compared to conventional sensing materials. We tested two measurement systems: a stationary and a portable/low-cost system. Both systems demonstrated similar responses, with the stationary system exhibiting better accuracy offset compared to the portability of the latter. Here, the sensor looks to work stably and selectively at room temperature, detecting up to 160 ppb HAc (LOD) in ambient air with a selectivity of 96% among the tested VOCs. In contrast, the portable system can be directly used in workplaces, monitoring and storing data on workers’ exposure to acetic vapors. On the other hand, it displays a LOD of ~1 ppm and a LOQ of ~3 ppm, staying within workplace exposure limits based on TWA and STEL values. Based on this encouraging data, further developments could focus on enhancing the portable sensor unit for real-time monitoring, enabling timely alerts to workers in the event of dangerous concentrations, and facilitating wearable applications. The sensor’s design not only ensures rapid and reliable results but also opens up a world of possibilities for enhanced process control and risk mitigation in various industries. With its compact and cost-effective architecture, it may ensure the prevention of potential health risks, promoting a safer work environment. The fabrication process for the chemosensor is straightforward and easily implementable, making it accessible and cost-effective for large-scale production. Additionally, its compact and lightweight construction enables seamless integration into wearable devices or personal protective equipment, facilitating continuous monitoring of acetic acid levels. However, numerous factors still require definition to assess the potential usability of the sensor for prolonged use in relevant industrial or occupational settings. These factors include the impact of humidity and temperature changes on the sensor structure and functionality over time and potential hysteresis phenomena when exposed to high and prolonged concentrations of acetic acid (and/or interferents), among others. In conclusion, while the presented study has made significant strides in the development and characterization of the sensor for detecting acetic acid vapors, it is important to acknowledge that further studies are necessary to fully evaluate its suitability for prolonged use in relevant industrial or occupational settings. Key factors such as the impact of environmental conditions, long-term stability, and potential hysteresis effects need to be thoroughly investigated. Additionally, ongoing research and collaboration with industry partners will be essential to address these challenges and optimize the sensor’s performance for occupational safety and environmental monitoring. Supplementary Materials: The following supporting information can be downloaded at: https: //www.mdpi.com/article/10.3390/s24072174/s1. Sensors 2024, 24, 2174 19 of 22 Author Contributions: Conceptualization, A.M.; methodology, A.M.; formal analysis: P.P.; validation, P.P. and E.Z.; investigation, P.P., E.Z. and A.M.; resources, G.T.; data curation, P.P., C.D.N., F.N.M. and F.D.C.; writing—original draft preparation, A.M. and P.P.; writing—review and editing, all the Authors; project administration, A.M.; funding acquisition, A.M., C.D.N. and G.T. All authors have read and agreed to the published version of the manuscript. Funding: This research was funded by Istituto Nazionale Assicurazione contro gli Infortuni sul Lavoro (INAIL) through the Italian project BRIC2019-ID07-Integrated system of mobile and fixed sensors for dynamic spatio-temporal mapping of volatile compounds in work environment. Institutional Review Board Statement: Not applicable. Informed Consent Statement: Not applicable. Data Availability Statement: All data that support the findings of this study are available after the reasonable request to the corresponding author. Acknowledgments: Many thanks to Anna Rita Taddei of CGA-Tuscia University for her SEM analysis, A. Capocecera of IIA-CNR for his technical collaboration in software programming and using, and S. Berti and T. Davanzo (IIA-CNR) for their administrative support. Conflicts of Interest: The authors declare no conflicts of interest. References 1. Falahati, M.; Ahmadvand, P.; Safaee, S.; Chang, Y.C.; Lyu, Z.; Chen, R.; Li, L.; Lin, Y. Smart Polymers and Nanocomposites for 3D and 4D Printing. Mater. Today 2020, 40, 215–245. [CrossRef] 2. Idumah, C.I.; Obele, C.M.; Emmanuel, E.O.; Hassan, A. Recently Emerging Nanotechnological Advancements in Polymer Nanocomposite Coatings for Anti-Corrosion, Anti-Fouling and Self-Healing. Surf. Interfaces 2020, 21, 100734. [CrossRef] [PubMed] 3. Wu, H.; Fahy, W.P.; Kim, S.; Kim, H.; Zhao, N.; Pilato, L.; Kafi, A.; Bateman, S.; Koo, J.H. Recent Developments in Polymers/Polymer Nanocomposites for Additive Manufacturing. Prog. Mater. Sci. 2020, 111, 100638. [CrossRef] 4. Sarfraz, J.; Gulin-Sarfraz, T.; Nilsen-Nygaard, J.; Pettersen, M.K. Nanocomposites for Food Packaging Applications: An Overview. Nanomaterials 2021, 11, 10. [CrossRef] [PubMed] 5. Gong, M.; Zhang, L.; Wan, P. Polymer Nanocomposite Meshes for Flexible Electronic Devices. Prog. Polym. Sci. 2020, 107, 101279. [CrossRef] 6. Hossain, S.K.S.; Hoque, M.E. Polymer Nanocomposite Materials in Energy Storage: Properties and Applications; Elsevier Ltd.: Amsterdam, The Netherlands, 2018; ISBN 9780081019115. 7. Zhao, L.; Liu, J. Application of Polymer Nanocomposites in Biomedicine; INC: 2022; ISBN 9780323916110. 8. Panicker, S.; Mohamed, A.A. Polymer Nanocomposites for Drug Delivery Applications; INC: 2022; ISBN 9780323916110. 9. Ahmadi, Y.; Moeini, N.; Yadav, M.; Ahmad, S. Antimicrobial Polymer Nanocomposite Films and Coatings; INC: 2020; ISBN 9780128214978. 10. Aboulrous, A.A.; Mahmoud, T. Polymer Nanocomposites for Sensing Applications; Elsevier Ltd.: Amsterdam, The Netherlands, 2023; ISBN 9780323884310. 11. Damiri, F.; Gaiji, H.; Muhamad, I.I.; Lazim, N.A.M.; Kaur, D.; Berrada, M. Design and Fabrication of Polymer Nanocomposite Sensors; Elsevier Ltd.: Amsterdam, The Netherlands, 2022; ISBN 9780323988308. 12. Pineau, N.J.; Krumeich, F.; Güntner, A.T.; Pratsinis, S.E. Y-Doped ZnO Films for Acetic Acid Sensing down to Ppb at High Humidity. Sens. Actuators B Chem. 2021, 327, 128843. [CrossRef] 13. Wang, C.; Ma, S.; Sun, A.; Qin, R.; Yang, F.; Li, X.; Li, F.; Yang, X. Characterization of Electrospun Pr-Doped ZnO Nanostructure for Acetic Acid Sensor. Sens. Actuators B Chem. 2014, 193, 326–333. [CrossRef] 14. Turemis, M.; Zappi, D.; Giardi, M.T.; Basile, G.; Ramanaviciene, A.; Kapralovs, A.; Ramanavicius, A.; Viter, R. ZnO/Polyaniline Composite Based Photoluminescence Sensor for the Determination of Acetic Acid Vapor. Talanta 2020, 211, 120658. [CrossRef] 15. Chu, X.; Gan, Z.; Bai, L.; Dong, Y.; Rumyantseva, M.N. The Acetic Acid Vapor Sensing Properties of BaSnO3 Microtubes Prepared by Electrospinning Method. Mater. Sci. Eng. B 2020, 259, 114606. [CrossRef] 16. Qin, W.F.; Zhang, H.M.; Li, X.B.; Xing, Y.W.; Guo, Y.X.; Feng, Y.Y.; Li, Y.J.; Han, S.Q.; Ma, K.F.; Cao, H.H.; et al. Surfactant Modified Hexagonal ZnO Gas Sensor for Acetic Acid. J. Mater. Sci. Mater. Electron. 2023, 34, 1560. [CrossRef] 17. Ling, W.; Zhang, S.; Cao, S.; Pu, Y.; Zhu, D. Enhanced Acetic Acid Detection for Tb2O3 @MOF-Derived ZnO at Room Temperature. Sens. Actuators B Chem. 2023, 377, 133057. [CrossRef] 18. Zappi, D.; Varani, G.; Iatsunskyi, I.; Wallaszkovits, N.; Bailer, J.; Giardi, M.T. High-Sensitivity Metal Oxide Sensors Duplex for On-the-Field Detection of Acetic Acid Arising from the Degradation of Cellulose Acetate-Based Cinematographic and Photographic Films. Chemosensors 2022, 10, 60. [CrossRef] Sensors 2024, 24, 2174 20 of 22 19. Rizani, A.; Winingsih, S.S.; Aditya, R.; Julian, T.; Hidayat, S.N.; Kusumaatmaja, A.; Roto, R.; Triyana, K. Polyacrylamide Coated on Quartz Crystal Microbalance Electrodes for Highly Sensitive Sensor of Acetic Acid. Mater. Sci. Forum 2019, 948, 254–259. [CrossRef] 20. Cai, J.; Yan, Y.; Wang, W.; Ma, Y.; Cai, L.; Wu, L.; Zhou, H. Detection of Formic Acid and Acetic Acid Gases by a QCM Sensor Coated with an Acidified Multi-Walled Carbon Nanotube Membrane. Environ. Technol. 2021, 44, 751–761. [CrossRef] [PubMed] 21. Wang, Y.C.; Sun, Z.; Wang, S.Z.; Wang, S.Y.; Cai, S.X.; Huang, X.Y.; Li, K.; Chi, Z.T.; Pan, S.D.; Xie, W.F. Sub-Ppm Acetic Acid Gas Sensor Based on In2O3 Nanofibers. J. Mater. Sci. 2019, 54, 14055–14063. [CrossRef] 22. Li, G.; Su, Y.; Li, Y.Y.; Li, Y.X.; Guo, Z.; Huang, X.J.; Liu, J.H. Size-Tunable Ag Nanoparticles Sensitized Porous ZnO Nanobelts: Controllably Partial Cation-Exchange Synthesis and Selective Sensing toward Acetic Acid. Nanotechnology 2018, 29, 445501. [CrossRef] [PubMed] 23. Khorramshahi, V.; Karamdel, J.; Yousefi, R. Acetic Acid Sensing of Mg-Doped ZnO Thin Films Fabricated by the Sol–Gel Method. J. Mater. Sci. Mater. Electron. 2018, 29, 14679–14688. [CrossRef] 24. Jin, W.X.; Ma, S.Y.; Tie, Z.Z.; Li, W.Q.; Luo, J.; Cheng, L.; Xu, X.L.; Wang, T.T.; Jiang, X.H.; Mao, Y.Z. Synthesis of Hierarchical SnO2 Nanoflowers with Enhanced Acetic Acid Gas Sensing Properties. Appl. Surf. Sci. 2015, 353, 71–78. [CrossRef] 25. Cheng, L.; Ma, S.Y.; Wang, T.T.; Luo, J.; Li, X.B.; Li, W.Q.; Mao, Y.Z.; Gz, D.J. Highly Sensitive Acetic Acid Gas Sensor Based on Coral-like and Y-Doped SnO2 Nanoparticles Prepared by Electrospinning. Mater. Lett. 2014, 137, 265–268. [CrossRef] 26. Web Page. Available online: https://www.gas-sensing.com/ati-acid-gases-sensor-00-1045.html (accessed on 27 February 2024). 27. Web Page. Available online: https://www.draeger.com/en-us\_us/Products/Short-term-Tubes?s=202 (accessed on 27 February 2024). 28. Chen, Y.; Yang, Y.; Liu, X.; Shi, X.; Wang, C.; Zhong, H.; Jin, F. Sustainable Production of Formic Acid and Acetic Acid from Biomass. Mol. Catal. 2023, 545, 113199. [CrossRef] 29. European Union Commission Commission Directive (EU) 2017/164 of 31 January 2017 Establishing a Fourth List of Indicative Occupational Exposure Limit Values Pursuant to Council Directive 98/24/EC, and Amending Commission Directives 91/322. 2000, EEC39. Official Journal of European Union., 01/02/2017, L27/115. Available online: https://eur-lex.europa.eu/legalcontent/EN/TXT/PDF/?uri=CELEX:32017L0164 (accessed on 27 February 2024). 30. Chu, X.; Dai, P.; Dong, Y.; Sun, W.; Bai, L.; Zhang, W. The Acetic Acid Gas Sensing Properties of Graphene Quantum Dots (GQDs)–ZnO Nanocomposites Prepared by Hydrothermal Method. J. Mater. Sci. Mater. Electron. 2017, 28, 19164–19173. [CrossRef] 31. Geng, W.; Ma, Z.; Yang, J.; Duan, L.; Li, F.; Zhang, Q. Pore Size Dependent Acetic Acid Gas Sensing Performance of Mesoporous CuO. Sens. Actuators B Chem. 2021, 334, 129639. [CrossRef] 32. Aziz, N.A.; Abdullah, M.F.; Badaruddin, S.A.M.; Hussin, M.R.M.; Hashim, A.M. Highly Sensitive Sub-ppm CH3COOH Detection by Improved Assembly of Sn3O4-RGO Nanocomposite. Molecules 2022, 27, 8707. [CrossRef] [PubMed] 33. Khorramshahi, V.; Karamdel, J.; Yousefi, R. High Acetic Acid Sensing Performance of Mg-Doped ZnO/RGO Nanocomposites. Ceram. Int. 2019, 45, 7034–7043. [CrossRef] 34. He, L.; Gao, C.; Yang, L.; Zhang, K.; Chu, X.; Liang, S.; Zeng, D. Facile Synthesis of MgGa2O4/Graphene Composites for Room Temperature Acetic Acid Gas Sensing. Sens. Actuators B Chem. 2020, 306, 127453. [CrossRef] 35. Avossa, J.; Zampetti, E.; De Cesare, F.; Bearzotti, A.; Scarascia-Mugnozza, G.; Vitiello, G.; Zussman, E.; Macagnano, A. Thermally Driven Selective Nanocomposite PS-PHB/MGC Nanofibrous Conductive Sensor for Air Pollutant Detection. Front. Chem. 2018, 6, 432. [CrossRef] [PubMed] 36. Utkarsh; Hegab, H.; Tariq, M.; Syed, N.A.; Rizvi, G.; Pop-Iliev, R. Towards Analysis and Optimization of Electrospun PVP (Polyvinylpyrrolidone) Nanofibers. Adv. Polym. Technol. 2020, 2020, 4090747. [CrossRef] 37. Maciejewska, B.M.; Wychowaniec, J.K.; Woz´niak-Budych, M.; Popenda, Ł.; Warowicka, A.; Golba, K.; Litowczenko, J.; Fojud, Z.; Wereszczyn´ ska, B.; Jurga, S. UV Cross-Linked Polyvinylpyrrolidone Electrospun Fibres as Antibacterial Surfaces. Sci. Technol. Adv. Mater. 2019, 20, 979–991. [CrossRef] 38. Wang, T.; Huang, D.; Yang, Z.; Xu, S.; He, G.; Li, X.; Hu, N.; Yin, G.; He, D.; Zhang, L. A Review on Graphene-Based Gas/Vapor Sensors with Unique Properties and Potential Applications. Nano-Micro Lett. 2016, 8, 95–119. [CrossRef] 39. Bolotin, K.I.; Sikes, K.J.; Jiang, Z.; Klima, M.; Fudenberg, G.; Hone, J.; Kim, P.; Stormer, H.L. Ultrahigh Electron Mobility in Suspended Graphene. Solid State Commun. 2008, 146, 351–355. [CrossRef] 40. Park, J.; Lee, J.; Kim, S.; Hwang, J. Graphene-Based Two-Dimensional Mesoporous Materials: Synthesis and Electrochemical Energy Storage Applications. Materials 2021, 14, 2597. [CrossRef] [PubMed] 41. Matatagui, D.; López-Sánchez, J.; Peña, A.; Serrano, A.; del Campo, A.; de la Fuente, O.R.; Carmona, N.; Navarro, E.; Marín, P.; del Carmen Horrillo, M. Ultrasensitive NO2 Gas Sensor with Insignificant NH3-Interference Based on a Few-Layered Mesoporous Graphene. Sens. Actuators B Chem. 2021, 335, 129657. [CrossRef] 42. Han, T.H.; Huang, Y.-K.; Tan, A.T.L.; Dravid, V.P.; Huang, J. Steam Etched Porous Graphene Oxide Network for Chemical Sensing. J. Am. Chem. Soc. 2011, 133, 15264–15267. [CrossRef] [PubMed] 43. Kanjwal, M.A.; Ghaferi, A. Al Graphene Incorporated Electrospun Nanofiber for Electrochemical Sensing and Biomedical Applications: A Critical Review. Sensors 2022, 22, 8661. [CrossRef] [PubMed] 44. Avossa, J.; Paolesse, R.; Di Natale, C.; Zampetti, E.; Bertoni, G.; De Cesare, F.; Scarascia-Mugnozza, G.; Macagnano, A. Electrospinning of Polystyrene/Polyhydroxybutyrate Nanofibers Doped with Porphyrin and Graphene for Chemiresistor Gas Sensors. Nanomaterials 2019, 9, 280. [CrossRef] [PubMed] Sensors 2024, 24, 2174 21 of 22 45. Angkawinitwong, U.; Williams, G.R. Electrospun Materials for Wearable Sensor Applications in Healthcare; Elsevier Ltd.: Amsterdam, The Netherlands, 2020; ISBN 9780128196113. 46. Das, R.; Zeng, W.; Asci, C.; Del-Rio-Ruiz, R.; Sonkusale, S. Recent Progress in Electrospun Nanomaterials for Wearables. APL Bioeng. 2022, 6, 21505. [CrossRef] 47. Gilmore, T.; Gouma, P. Novel Electrospinning Process for Wearable Sensors. ECS Meet. Abstr. 2022, MA2022-01, 1035. [CrossRef] 48. Massaglia, G.; Quaglio, M. Electrospun Nanofibers for Optimized Fiber-Shaped Wearable Sensors. Mater. Proc. 2023, 14, 55. [CrossRef] 49. Macagnano, A.; Zampetti, E.; Kny, E. (Eds.) Electrospinning for High Performance Sensors; NanoScience and Technology; Springer International Publishing: Cham, Switzerland, 2015; ISBN 978-3-319-14405-4. 50. Wang, L.; Qin, X. (Eds.) Electrospinning; Wiley: Hoboken, NJ, USA, 2024; ISBN 9783527351978. 51. Kausar, A.; Ahmad, I.; Zhao, T.; Aldaghri, O.; Ibnaouf, K.H.; Eisa, M.H. Nanocomposite Nanofibers of Graphene—Fundamentals and Systematic Developments. J. Compos. Sci. 2023, 7, 323. [CrossRef] 52. De, S.; Sahoo, S.; Das, A.K.; Nayak, G.C. Recent Progress in Electrospinning Technologies for Graphene-Based Materials. In Electrospinning of Graphene; Springer: Cham, Switzerland, 2021; pp. 1–34. 53. Al-Dhahebi, A.M.; Gopinath, S.C.B.; Saheed, M.S.M. Graphene Impregnated Electrospun Nanofiber Sensing Materials: A Comprehensive Overview on Bridging Laboratory Set-up to Industry. Nano Converg. 2020, 7, 27. [CrossRef] 54. Wang, Y.; Yokota, T.; Someya, T. Electrospun Nanofiber-Based Soft Electronics. NPG Asia Mater. 2021, 13, 22. [CrossRef] 55. Guo, Z.; Huang, J.; Xue, Z.; Wang, X. Electrospun Graphene Oxide/Carbon Composite Nanofibers with Well-Developed Mesoporous Structure and Their Adsorption Performance for Benzene and Butanone. Chem. Eng. J. 2016, 306, 99–106. [CrossRef] 56. Storti, E.; Lojka, M.; Lencová, S.; Hubálková, J.; Jankovský, O.; Aneziris, C.G. Synthesis and Characterization of Graphene Nanoplatelets-Containing Fibers by Electrospinning. Open Ceram. 2023, 15, 100395. [CrossRef] 57. Del Sorbo, G.; Truda, G.; Bifulco, A.; Passaro, J.; Petrone, G.; Vitolo, B.; Ausanio, G.; Vergara, A.; Marulo, F.; Branda, F. Non Monotonous Effects of Noncovalently Functionalized Graphene Addition on the Structure and Sound Absorption Properties of Polyvinylpyrrolidone (1300 KDa) Electrospun Mats. Materials 2018, 12, 108. [CrossRef] [PubMed] 58. Kaczmarek, H.; Szalla, A.; Kamin´ ska, A. Study of Poly(Acrylic Acid)–Poly(Vinylpyrrolidone) Complexes and Their Photostability. Polymer 2001, 42, 6057–6069. [CrossRef] 59. Wajid, A.S.; Das, S.; Irin, F.; Ahmed, H.S.T.; Shelburne, J.L.; Parviz, D.; Fullerton, R.J.; Jankowski, A.F.; Hedden, R.C.; Green, M.J. Polymer-Stabilized Graphene Dispersions at High Concentrations in Organic Solvents for Composite Production. Carbon N. Y. 2012, 50, 526–534. [CrossRef] 60. Song, G.; Lin, Y.; Zhu, Z.; Zheng, H.; Qiao, J.; He, C.; Wang, H. Strong Fluorescence of Poly(N-Vinylpyrrolidone) and Its Oxidized Hydrolyzate. Macromol. Rapid Commun. 2015, 36, 278–285. [CrossRef] [PubMed] 61. Louie, S.M.; Gorham, J.M.; Tan, J.; Hackley, V.A. Ultraviolet Photo-Oxidation of Polyvinylpyrrolidone (PVP) Coatings on Gold Nanoparticles. Environ. Sci. Nano 2017, 4, 1866–1875. [CrossRef] [PubMed] 62. Chen, L.; Raohao, F.; Changchang, Z.; Xiang, L.; Changhua, Z. Fluorescent Enhancement of Polyethyleneimine Nano-Polymers and the Application in Cellar Imaging. Polym. Degrad. Stab. 2019, 163, 7–14. [CrossRef] 63. Khan, W.S.; Asmatulu, R.; Eltabey, M.M. Electrical and Thermal Characterization of Electrospun PVP Nanocomposite Fibers. J. Nanomater. 2013, 2013, 160931. [CrossRef] 64. Gillan, L. Inkjet Printed Metal Oxide Thin Film Transistors Incorporating Polyethyleneimine. Master’s Thesis, School of Chemical Engineering, Aalto University, Espoo, Finland, 2017. 65. Roizard, D. Antoine Equation. In Encyclopedia of Membranes; Springer: Berlin/Heidelberg, Germany, 2014; pp. 1–3. 66. D’Amico, A.; Di Natale, C. A Contribution on Some Basic Definitions of Sensors Properties. IEEE Sens. J. 2001, 1, 183–190. [CrossRef] 67. Wu, J.; Wan, Y.; Wang, Z.; Wang, Y.; Luo, Q.; Feng, C.; Yoshinobu, T. Loose Ag-Doped LaFeO3 Nanotubes-Based Gas Sensor for Excellent Acetic Acid Sensing. IEEE Sens. J. 2024, 24, 5821–5829. [CrossRef] 68. Zhang, J.; Liao, F.; Zhu, Y.; Sun, J.; Shao, M. Visible-Light-Enhanced Gas Sensing of CdSxSe1-x Nanoribbons for Acetic Acid at Room Temperature. Sens. Actuators B Chem. 2015, 215, 497–503. [CrossRef] 69. Gautam, M.; Jayatissa, A.H. Detection of Organic Vapors by Graphene Films Functionalized with Metallic Nanoparticles. J. Appl. Phys. 2012, 112, 114326. [CrossRef] 70. Huang, X.Y.; Chen, K.; Xie, W.; Li, Y.; Yang, F.; Deng, Y.; Li, J.; Jiang, F.; Shu, Y.; Wu, L.; et al. Chemiresistive Gas Sensors Based on Highly Permeable Sn-Doped Bismuth Subcarbonate Microspheres: Facile Synthesis, Sensing Performance, and Mechanism Study. Adv. Funct. Mater. 2023, 33, 2304718. [CrossRef] 71. Bi, W.; Liu, S. Preparation of a Hierarchical 3D Structure Composed of Co-Doped SnO2 Nanosheets with Excellent Gas Sensitivity to Acetic Acid. Mater. Sci. Eng. B 2022, 286, 116006. [CrossRef] 72. Cao, P.F.; Ma, S.Y.; Fan, R.J. Carbon-Doped Porous Hollow Alpha-Fe2O3 Microtubules Controlled by Absorbent Cotton BioTemplate to Detect Acetic Acid Vapor. Ceram. Int. 2022, 48, 12729–12741. [CrossRef] 73. Han, D. Sol-Gel Autocombustion Synthesis of Zinc Oxide Foam Decorated with Holes and Its Use as Acetic Acid Gas Sensor at Sub-Ppm Level. Ceram. Int. 2020, 46, 3304–3310. [CrossRef] Sensors 2024, 24, 2174 22 of 22 74. Zhang, Y.; Liu, J.; Chu, X.; Liang, S.; Kong, L. Preparation of g–C3N4–SnO2 Composites for Application as Acetic Acid Sensor. J. Alloys Compd. 2020, 832, 153355. [CrossRef] 75. Gauglitz, G. Analytical Evaluation of Sensor Measurements. Anal. Bioanal. Chem. 2018, 410, 5–13. [CrossRef] Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.Ver+/- |
